Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate WP_015798223.1 AFER_RS04045 5-carboxymethyl-2-hydroxymuconate Delta-isomerase
Query= BRENDA::A0A076VF18 (308 letters) >NCBI__GCF_000023265.1:WP_015798223.1 Length = 286 Score = 119 bits (299), Expect = 6e-32 Identities = 78/214 (36%), Positives = 113/214 (52%), Gaps = 14/214 (6%) Query: 79 AIRGMGLQYSG--DPANPQDKPPVACLFFKASQALAGPGDDIVLPRLARDEKNDYEVELC 136 AI +GL Y+ D ++P LF K ++L GP D I LP + + D+EVE+ Sbjct: 69 AIICLGLNYAKHMDEMGHDERPAFPTLFAKFPRSLTGPFDQITLPVTSHEV--DWEVEIG 126 Query: 137 VVLGKDAKDVDEKDAMSFVGGYCVVNDVSSRGLCAKGGQWGMGKSYDTWCPFGPCLVSPS 196 VV+G+ A+ VD A+ V GY VVNDVS R + Q+ GK ++ P GP +V+ Sbjct: 127 VVIGRRARHVDVAHALEHVAGYVVVNDVSMRDYQHRTSQFLQGKIFEASTPVGPWMVTRD 186 Query: 197 ALGADPHKLTITTHVNGKLAQKGNTADLVLKIPELIARLSHGTTLQAGSLILTGSP--IA 254 + D + +TT VNG Q G + D++ +P IA LS TL+ G LI G+P + Sbjct: 187 EVD-DVRDVALTTRVNGTTMQDGRSRDMLFDVPTTIAYLSEIMTLEPGDLIAMGTPDGVG 245 Query: 255 LGRKAPGDAVEQSPFMKDGDEIRCFVEGCGTLIN 288 GR+ P F++ GD + VEG GT+ N Sbjct: 246 AGRRPP-------VFLRPGDVVESSVEGIGTMRN 272 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 286 Length adjustment: 26 Effective length of query: 282 Effective length of database: 260 Effective search space: 73320 Effective search space used: 73320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory