Align L-rhamnose-1-dehydrogenase ( EC 1.1.1.173) (characterized)
to candidate WP_015798506.1 AFER_RS05575 3-oxoacyl-ACP reductase FabG
Query= reanno::BFirm:BPHYT_RS28235 (260 letters) >NCBI__GCF_000023265.1:WP_015798506.1 Length = 239 Score = 119 bits (297), Expect = 8e-32 Identities = 87/248 (35%), Positives = 120/248 (48%), Gaps = 16/248 (6%) Query: 8 VIVTGGSRGIGRAIAVACAAEGADVAINYWGDNDVSYGRRSAVAEVVAEIEALGRRVIAI 67 V+VTG + GIG A A G ++ R +V+A V + Sbjct: 4 VLVTGAASGIGLATVRTLQASGFTIS--------AGVHHRPMPDDVLA-----AGNVTPV 50 Query: 68 EGNVAARETGQQLVRHTVEAFGKVDVLASNAGICPFHAFLDMPPEVLESTVAVNLNGAFY 127 E +V E+ + V A G ++ L +NAG+ L M +T+ +NL AF Sbjct: 51 ELDVTNSESVLKAVAAAEAANGTIEALIANAGLTDDQLLLRMDEASWAATIDLNLTSAFR 110 Query: 128 VTQAAAQQMKLQGTGGAIVATSSISALVGGGMQTHYTPTKAGVHSLMQSCAVALGPYGIR 187 + +A +M L+ G IV SS+ AL+G QT Y KAG+ +S A +G GI Sbjct: 111 LAKAVVPRM-LKARRGRIVFVSSVVALLGSPGQTSYAAAKAGLVGFARSLAREVGSRGIT 169 Query: 188 CNSVMPGTIATDLNAQDLADEAKKAYFEKRIPLGRLGRPEDVADCVTFLASDRARYVTGA 247 N VMPG I TDL E + A ++PLGR GRPE+ A + FL SD A YVTG+ Sbjct: 170 VNVVMPGMIDTDLLRA--TGEQRLASILSQVPLGRTGRPEEAASVLAFLVSDAASYVTGS 227 Query: 248 ALLVDGGL 255 + VDGGL Sbjct: 228 VIPVDGGL 235 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 239 Length adjustment: 24 Effective length of query: 236 Effective length of database: 215 Effective search space: 50740 Effective search space used: 50740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory