Align (S)-3-hydroxybutanoyl-CoA dehydrogeanse (EC 1.1.1.35) (characterized)
to candidate WP_015798785.1 AFER_RS07080 3-hydroxyacyl-CoA dehydrogenase
Query= metacyc::MONOMER-19851 (285 letters) >NCBI__GCF_000023265.1:WP_015798785.1 Length = 288 Score = 200 bits (508), Expect = 3e-56 Identities = 123/286 (43%), Positives = 176/286 (61%), Gaps = 8/286 (2%) Query: 1 MANPPG--SIGVIGAGTMGNGIAQVCAVAGLNVTMLDVDDAALKRGMDTIIRNLDRMVAK 58 + PP +I VIG GTMG+GIA VAG +VT+++V DAA ++ ++ + R LD+ VA Sbjct: 9 LGQPPAIRTIVVIGGGTMGSGIAAQAVVAGRDVTVVEVSDAAARQTVERVERLLDQAVA- 67 Query: 59 EKLTASARDAALAKISTGLDYGALQSADMVIEAATENLGLKLKILRQVANCVGKDAIIAT 118 SA A A+ +GLD A+ +AD+VIE+ E + LK ++L + +DAI AT Sbjct: 68 HGAERSAFGAVAAR--SGLD--AVVAADLVIESVPEVVELKREVLHSASKIARRDAIFAT 123 Query: 119 NTSSISITQLGAVLDAPECFIGIHFFNPVPLMSLLEVIRGVQTSDATHAATMAFAQKVGK 178 NTSSI + L + + P F G+HFFNPV L+EV+ G TS+AT A +A A+ GK Sbjct: 124 NTSSIQVADLASSVQDPSRFGGLHFFNPVLPSQLIEVVVGGATSEATTDALVAAARGFGK 183 Query: 179 APITVRNSPGFVVNRILCPMINEAIFVLQEGLASAEGIDVGMRLGCNHPIGPLALADMIG 238 PI VR+ PGF +R+ + EA +L+E +ASAE ID GM+LG HP+GPL L+D++G Sbjct: 184 EPIVVRDRPGFATSRLGVLLGLEAARMLEEEVASAEDIDRGMQLGYRHPVGPLRLSDLVG 243 Query: 239 LDTLLSIMGVLYDEFNDPKYRPALLLKEMVAAGRLGRKTKQGFYSY 284 LD L I L ++ P +L + VA G LGRK+ +GF+ + Sbjct: 244 LDVRLQIARYLAVHLGS-RFEPPQILIDKVARGELGRKSGRGFFEW 288 Lambda K H 0.321 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 288 Length adjustment: 26 Effective length of query: 259 Effective length of database: 262 Effective search space: 67858 Effective search space used: 67858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory