Align UDP-glucose 4-epimerase; UDP-galactose 4-epimerase; Uridine diphosphate galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_015816886.1 TERTU_RS19225 dTDP-glucose 4,6-dehydratase
Query= SwissProt::A0R5C5 (313 letters) >NCBI__GCF_000023025.1:WP_015816886.1 Length = 356 Score = 125 bits (315), Expect = 1e-33 Identities = 109/353 (30%), Positives = 164/353 (46%), Gaps = 53/353 (15%) Query: 4 LVTGAAGFIGSTLVDRLLAD--GHGVVGLDDLS-SGRAENLHSAENSDKFEFVKADIVDA 60 LVTG AGFIG+ V L V+ LD L+ +G NL + E+ + F FVK DI+D Sbjct: 6 LVTGGAGFIGANFVHYWLETYPADRVIVLDALTYAGNPANLTAVESVENFRFVKGDILDQ 65 Query: 61 DLTG-LLAEFKPEVIFHLAAQISVKRSVDDPPFDATVNVVGTVRLAEAARLAGVRKVV-- 117 L LL + + + H AA+ V RS+ P N+VGT L +AA+ + + + Sbjct: 66 PLVEQLLRDNSVDTLVHFAAESHVDRSITGPDAFIETNIVGTHTLLKAAKKVWLDEGLCK 125 Query: 118 -----HTSSGGSVYGT----PPAYPTSEDMPVNPASPYAAGKVAGEVYLNMYRNLYDLDC 168 H S VYGT PA+ SE P P SPY+A K A + + Y + Y L Sbjct: 126 EGHRFHHISTDEVYGTLGPNDPAF--SETTPYAPNSPYSASKAASDHLVRSYLHTYGLQV 183 Query: 169 SHIAPANVYGPRQDPHGEAGVVAIFSEALLAGRTTKIFGDGSDTRDYVFVDDV---VDAF 225 + +N YGP P ++ + +L R ++GDG RD+++V D +D Sbjct: 184 TTSNCSNNYGPFHFPEK---LIPLIITNILRDRKLPVYGDGKQIRDWLYVTDHARGIDLV 240 Query: 226 VRAGGPAGGGQRFNVGTGVETSTREL-------------------------HTAIAGAVG 260 +R G G+ +N+G E + ++ +AIAG Sbjct: 241 LRKGVV---GESYNIGGINEWANIDIVQLVCKLMNERFAASSVLAERFPNARSAIAGT-- 295 Query: 261 APDEPEFHPPRLGDLRRSRLDNTRAREVLGWQPQVALAEGIAKTVEFFRNKSQ 313 A D EF R G RR +D T+A LG++PQ + GIAKT++++ + + Sbjct: 296 AADLIEFVTDRPGHDRRYAIDPTKANAELGYKPQESFDTGIAKTIDWYLDNQE 348 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 356 Length adjustment: 28 Effective length of query: 285 Effective length of database: 328 Effective search space: 93480 Effective search space used: 93480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory