Align L-proline uptake porter, PutP (characterized)
to candidate WP_015818258.1 TERTU_RS08815 sodium/proline symporter
Query= TCDB::Q9I5F5 (506 letters) >NCBI__GCF_000023025.1:WP_015818258.1 Length = 472 Score = 194 bits (494), Expect = 4e-54 Identities = 135/474 (28%), Positives = 228/474 (48%), Gaps = 30/474 (6%) Query: 8 LITFVIYIAAMVLIGLAAY-RSTNNFSDYILGGRSLGSFVTALSAGASDMSGWLLMGLPG 66 + +F++++A +G++++ +S DY L S+ ++ LSA A++ SG++ +GL G Sbjct: 2 IFSFLLFLAFFTAVGISSWLKSQGTKKDYYLASSSIAPWLVGLSAVATNNSGYMFIGLIG 61 Query: 67 AVYLSGLSESWIAIGLIVGAYLNWLFVAGRLRVQTEHNGNALTLPDYFTNRFEDNSRLLR 126 Y++GLS W+ +G I G ++ LFV RL TE+N + ++ N + ++ L+ Sbjct: 62 YTYIAGLSSIWLMLGWICGDFVASLFVHKRLHKATENN-SEVSYAGVLANWYGESRDGLQ 120 Query: 127 IFSALVILVFFTIYCASGIVAGARLFESTFGLSYETALWAGAAATIAYTFIGGFLAVSWT 186 ++ L+F Y A+ +VAG++ + GA Y GG A WT Sbjct: 121 RLIGVISLLFLLTYAAAQLVAGSKALHVLLSWPIWSGAVVGAVVVALYCLAGGIRASIWT 180 Query: 187 DTVQASLMIFALILTPVIVMLATGGVEPTFTAIELKDATSFDMLKGASFIGVISLMAWGL 246 D Q+ +MI A+ L + + + GG+ T A+ D + G+ + + Sbjct: 181 DAAQSIVMIGAMALLLAVAIASLGGIGGTLDALGQIDGFLNVLPGDLPVPGITGWILFTF 240 Query: 247 GYF-------GQPHILARFMAADSVKSIPAARRISMTWMILCLGGAVAVGFFGIAYFQAH 299 G+F GQPH++ RFMA + + + AR TW ++ A VG Y Sbjct: 241 GWFVAGASVIGQPHVMVRFMALEHSQKMVQARVWYYTWFVVFWAMANGVGMLSRVYL--- 297 Query: 300 PEQAGAVSENPERVFIELAKILFNPWIAGVLLSAILAAVMSTLSCQLLVCSSALTEDFYK 359 PE S + E LA+ L +P+ G++L+ I AA MST LL CS+A+T D Sbjct: 298 PEVG---SFDAELALPTLAQELLSPFFVGMILAGIFAATMSTADSLLLSCSAAITHDII- 353 Query: 360 AFLRKGASQLELVWVGRAMVLLVAVIAIWLASNPENRVLGLVSYAWAGFGAAFGPLVLFS 419 LE W+ + +L+ IA+ +A V +V AW+G G+AF PL++ Sbjct: 354 ------PHSLEQPWILKLATVLITGIALLIALANNQSVFSMVIMAWSGLGSAFAPLLIAQ 407 Query: 420 LLWKRMTRNGALAGMIVGAATVILWKNLLGWTGLYEIIPGFLFASVAIVVFSLL 473 L +R ++ A+ + VG T +LW++ G + II F VA + L+ Sbjct: 408 SLGRRPSQILAIIAITVGFTTALLWRHF----GFHNII----FEGVAGIAAGLI 453 Lambda K H 0.326 0.138 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 764 Number of extensions: 38 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 506 Length of database: 472 Length adjustment: 34 Effective length of query: 472 Effective length of database: 438 Effective search space: 206736 Effective search space used: 206736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory