Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_015818865.1 TERTU_RS16925 LPS export ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_000023025.1:WP_015818865.1 Length = 241 Score = 129 bits (323), Expect = 7e-35 Identities = 70/220 (31%), Positives = 120/220 (54%), Gaps = 5/220 (2%) Query: 24 INFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEIIFKGENITGLGSDQIVRRGMC 83 ++ S+ G++V ++GPNGAGK+T I G++ G+I + +T L + R G+ Sbjct: 22 VSLSVDSGQIVGLLGPNGAGKTTCFYMIAGIIKADHGDIQIGDKRVTHLPMHERARAGLG 81 Query: 84 YVPQVCNVFGSLTVAEN----LDMGAFLHQGPTQTLKDRIYTMFPKLAQRRNQRAGTLSG 139 Y+PQ +VF LTV +N L+ L + + +++ F + RN LSG Sbjct: 82 YLPQEASVFRKLTVQDNILAILETRKELSRNQRREAMEKLLEEF-HIGHIRNSLGMALSG 140 Query: 140 GERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKAINATGKAIILVEQNAKQA 199 GER+ + + RAL +PD +LLDEP A + PI V D+ ++ + G +++ + N ++ Sbjct: 141 GERRRVEIARALATEPDFVLLDEPFAGVDPISVSDIKQIVQHLKNRGIGVLITDHNVRET 200 Query: 200 LMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLGAAYH 239 L + ++ Y++ G EGS +LN+ V E+YLG +H Sbjct: 201 LDICEKAYIVSEGHIIAEGSANDVLNNKKVREVYLGQHFH 240 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 241 Length adjustment: 23 Effective length of query: 217 Effective length of database: 218 Effective search space: 47306 Effective search space used: 47306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory