Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_015819305.1 TERTU_RS05810 NAD-dependent dehydratase
Query= BRENDA::O73960 (318 letters) >NCBI__GCF_000023025.1:WP_015819305.1 Length = 332 Score = 143 bits (360), Expect = 7e-39 Identities = 105/319 (32%), Positives = 165/319 (51%), Gaps = 22/319 (6%) Query: 1 MRVLVTGGAGFIGSHLVDRLMEEGYKVRVLDDLSAGSLKNIEGWL----GNENFEFIKGD 56 +RVLVTG GFIGSHLV+RL+++GYKVR L ++ N GWL + + E I GD Sbjct: 8 VRVLVTGADGFIGSHLVERLLQQGYKVRALAQYNS---LNHWGWLEDVPAHPHLEIITGD 64 Query: 57 MRDVEIVSKAVKDVDAVFHLAANPEVRIGSQSPELLYETNVLITYNLLNAVRNSGVKYLV 116 + D + +D+ VFHLAA + ++P ETNV T N+ A + GV + Sbjct: 65 ILDATCCREITRDIHTVFHLAALIAIPFSYRAPSRYIETNVTGTLNMCQAALDQGVVRFL 124 Query: 117 FTSSSTVYGDAKVIPTPEDYAPLEPISVYGAAKLAAEALISGYAHTFDFRALIIRLANII 176 TS+S VYG A+ +P E + PL+ S Y A+K+ A+AL + + +F+ I+R N Sbjct: 125 QTSTSEVYGTAQYVPIDEAH-PLQAQSPYSASKIGADALATSFHRSFELPLTIVRPFNTY 183 Query: 177 GKR-SNHGVIYDFINKLKANPNELEILGDGTQRKSYLHISDTIDGIMKLFEHFLNGEERV 235 G R S VI I ++ A ++ LGD + + + ++DT DG + L N + + Sbjct: 184 GPRQSARAVIPTIITQIAAGAESIQ-LGDLSPTRDFSFVTDTCDGFIAL----ANCPQAI 238 Query: 236 -DFYNLGNEDWITVKEIAEIVSEEMNLNPRFKFTGGVDGGRGWKGDVKLMLLSIEKAK-- 292 + N+G+ I+V + E + E M N +F D R ++M L + +K Sbjct: 239 GETVNVGSNFEISVADTLEKIREIMGSNVKFM----TDQARLRPSASEVMRLWCDNSKYR 294 Query: 293 -RTGWKPRMNSYEAVRKTV 310 TG +P + + +R T+ Sbjct: 295 ALTGKQPEFSIDDGLRATI 313 Lambda K H 0.318 0.138 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 332 Length adjustment: 28 Effective length of query: 290 Effective length of database: 304 Effective search space: 88160 Effective search space used: 88160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory