Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_015820631.1 TERTU_RS06260 NAD-dependent epimerase
Query= BRENDA::F6DEY6 (311 letters) >NCBI__GCF_000023025.1:WP_015820631.1 Length = 333 Score = 114 bits (284), Expect = 4e-30 Identities = 99/338 (29%), Positives = 155/338 (45%), Gaps = 40/338 (11%) Query: 1 MRVLVTGGAGFIGSHIVEDLLARGLEVAVLDNLATG-----KRENVPKGVP---FFQV-- 50 M+ LVTG AGFIG+ + L+ G +V LDNL + K + K +P + QV Sbjct: 1 MKYLVTGSAGFIGAATAKRLVDEGHDVFGLDNLNSYYDPALKHHRLEKLLPCENYHQVTM 60 Query: 51 DLRDKEEVERAFREFRPTHVSHQAAQASVKVSVEDPVLDFEVNLLGGLNLLEACRQYGVE 110 DL D+E V + F + V H AQA V+ S+ P + N++G + +LE CR VE Sbjct: 61 DLADREGVAKLFANEKFQRVIHLGAQAGVRHSINAPFEYIDGNVVGTMTILEGCRHNNVE 120 Query: 111 KLVFASTGGAIYGEVPEGERAEETWPPRPKSPYAASKAAFEHYLSVYGQSYGLKWVSLRY 170 L++AS+ ++YG P+ AE P S YAA+K + E Y Y + LR+ Sbjct: 121 HLIYASS-SSVYGMNPKVPFAESDNVDHPVSLYAATKKSNELMAHAYSNLYDIPTTGLRF 179 Query: 171 GNVYGPRQDPHGEAGVVAIFAERVLNGLPVTLYARKTPGDEGCVRDYVYVGDVAEAHALA 230 VYGP P +F E +L G P+ ++ + RD+ Y+ D+ E L Sbjct: 180 FTVYGPAGRPDMAPW---LFTEAILKGEPIKVFNKGK-----MQRDFTYIDDIVEG-ILR 230 Query: 231 LFSL--------EG-----------IYNVGTGEGHTTREVLEAVAEAAGKAPQVQPAPPR 271 + ++ EG IYN+G ++A+ +A GK + P + Sbjct: 231 IQNVIPTPNPDDEGSNPSTSRAPYRIYNIGNNNPVELATFIDAIEQACGKKAEKILLPMQ 290 Query: 272 PGDLERSVLSPLKL-MAHGWRPKVGFQEGIRLTVDHFR 308 GD+ R+ L A +P V +G+ V+ ++ Sbjct: 291 AGDVVRTYADIDALTKATQHKPAVDIYDGVVQFVNWYK 328 Lambda K H 0.318 0.138 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 311 Length of database: 333 Length adjustment: 28 Effective length of query: 283 Effective length of database: 305 Effective search space: 86315 Effective search space used: 86315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory