Align UDP-glucose 4-epimerase (EC 5.1.3.7; EC 5.1.3.2) (characterized)
to candidate WP_015820685.1 TERTU_RS13920 UDP-glucose 4-epimerase GalE
Query= metacyc::BSU38860-MONOMER (339 letters) >NCBI__GCF_000023025.1:WP_015820685.1 Length = 339 Score = 479 bits (1233), Expect = e-140 Identities = 229/338 (67%), Positives = 275/338 (81%), Gaps = 2/338 (0%) Query: 1 MAILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLL 60 M+ILVTGGAGYIG+HTC+ELL++GYE+VV+DNL NS EALNRV+E++GK +TF + D+ Sbjct: 1 MSILVTGGAGYIGTHTCIELLSAGYEVVVVDNLCNSKREALNRVEEVSGKKVTFIQGDVT 60 Query: 61 DREAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIV 120 D+ + +F+E I+AVIHFAGLKAVGES IPL+YYH NL GT LCE ME +GV +++ Sbjct: 61 DKAVLRDIFSEYSIDAVIHFAGLKAVGESTQIPLRYYHTNLGGTVALCEVMEAFGVSRLL 120 Query: 121 FSSSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRD-LHTADNEWSVALLRYFNP 179 FSSSATVYG P ++PI E FP ATNPYG++KLM+E+ILRD N+W V LLRYFNP Sbjct: 121 FSSSATVYGDPASAPILETFPTSATNPYGRSKLMVEEILRDACRVPGNDWRVGLLRYFNP 180 Query: 180 FGAHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLA 239 GAHPSGR+GEDP GIPNNL+PYVAQVAVGKL +L VFG+DYPT DGTGVRDYIHVVDLA Sbjct: 181 IGAHPSGRLGEDPQGIPNNLLPYVAQVAVGKLAKLRVFGDDYPTVDGTGVRDYIHVVDLA 240 Query: 240 EGHVKALEKVLNSTGAD-AYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATC 298 GHV+ALEK+LN A YNLGTG GYSVL++V AF K GKE+PY A+RRPGDIA C Sbjct: 241 RGHVRALEKLLNCQPACLTYNLGTGQGYSVLQIVDAFAKACGKEIPYEIAERRPGDIAEC 300 Query: 299 FADPAKAKRELGWEAKRGLEEMCADSWRWQSSNVNGYK 336 +ADPA A ELGW+A+ GLE+M AD+WRWQSSN GY+ Sbjct: 301 YADPALATNELGWKAEYGLEQMVADTWRWQSSNPQGYE 338 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 479 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 339 Length adjustment: 28 Effective length of query: 311 Effective length of database: 311 Effective search space: 96721 Effective search space used: 96721 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_015820685.1 TERTU_RS13920 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.28361.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-141 457.4 0.0 1.3e-141 457.2 0.0 1.0 1 lcl|NCBI__GCF_000023025.1:WP_015820685.1 TERTU_RS13920 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000023025.1:WP_015820685.1 TERTU_RS13920 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 457.2 0.0 1.3e-141 1.3e-141 2 331 .. 3 336 .. 2 337 .. 0.98 Alignments for each domain: == domain 1 score: 457.2 bits; conditional E-value: 1.3e-141 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavlee 68 iLvtGgaGyiG h++ +ll++g+evvv+Dnl+++++eal+++e+++ +v++++gd++dk+ l+++++e lcl|NCBI__GCF_000023025.1:WP_015820685.1 3 ILVTGGAGYIGTHTCIELLSAGYEVVVVDNLCNSKREALNRVEEVSgkKVTFIQGDVTDKAVLRDIFSE 71 9*******************************************9999********************* PP TIGR01179 69 ekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEes 137 +idaviHfa+l+avgEs++ Pl+YY+ n+ +t+ L+e+m+++gv +l+Fsssa+vYg++ + pi E++ lcl|NCBI__GCF_000023025.1:WP_015820685.1 72 YSIDAVIHFAGLKAVGESTQIPLRYYHTNLGGTVALCEVMEAFGVSRLLFSSSATVYGDPASAPILETF 140 ********************************************************************* PP TIGR01179 138 plnpinpYGrsklmvErilkdlkka.dkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaevav 204 p++++npYGrsklmvE+il+d+ ++ ++++v +LRYFn++GA+++g++Ge++++++ +l+++va+vav lcl|NCBI__GCF_000023025.1:WP_015820685.1 141 PTSATNPYGRSKLMVEEILRDACRVpGNDWRVGLLRYFNPIGAHPSGRLGEDPQGIPnNLLPYVAQVAV 209 *********************9776379*****************************9*********** PP TIGR01179 205 gkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeg.gesevynlGagqgfsvkevieavk 272 gk+ kl++fG+dypt DGt+vRDyiHv Dla +H++ale+l + +ynlG+gqg+sv+++++a+ lcl|NCBI__GCF_000023025.1:WP_015820685.1 210 GKLAKLRVFGDDYPTVDGTGVRDYIHVVDLARGHVRALEKLLNCqPACLTYNLGTGQGYSVLQIVDAFA 278 *****************************************998356679******************* PP TIGR01179 273 kvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklkeg 331 k++gk+i++e+a+rR+GD+a+++ad++ +++elgwk++y+ Le++++++w+W++++++g lcl|NCBI__GCF_000023025.1:WP_015820685.1 279 KACGKEIPYEIAERRPGDIAECYADPALATNELGWKAEYG-LEQMVADTWRWQSSNPQG 336 ****************************************.**************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (339 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.00 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory