Align 1-pyrroline-5-carboxylate dehydrogenase 2; P5C dehydrogenase 2; EC 1.2.1.88; L-glutamate gamma-semialdehyde dehydrogenase (uncharacterized)
to candidate WP_015898975.1 PERMA_RS07860 DUF1487 domain-containing protein
Query= curated2:Q9K5Z5 (515 letters) >NCBI__GCF_000021565.1:WP_015898975.1 Length = 477 Score = 232 bits (591), Expect = 3e-65 Identities = 146/461 (31%), Positives = 236/461 (51%), Gaps = 20/461 (4%) Query: 38 PLVINGERVTTDDKIVSVNPAMKEQVIGVVSKASREIVDDAFKSAETAFHTWKNVNPEER 97 P++I G++V ++KI + P E+V G V K S E V+ A + A+T K ++ E+ Sbjct: 5 PMIIGGQKVYKEEKIDVIYPYTLEKV-GEVPKGSPEDVEKAIEKAKTGLKRLKELSSYEK 63 Query: 98 ANILIRAAAIIRRRKHEFSAWLVKEAGKPWKEADADTAEAIDFLEYYARQMITLK----- 152 IL++ A ++ RK EF+ +V E GK +EA + I+ + + A + ++ Sbjct: 64 YKILMKVAQLLEERKEEFAKTVVYEVGKTIREARTEVERCINTIIFSAEEAKRIEGEYVY 123 Query: 153 -DGKPVNSREGEHNRYFYTPIGVCVTISPWNFALAIMAGTTVAPIVTGNTVLLKPASTTP 211 D P + +G+ YF P G+ I+P+NF L + A I G +LKP+ TP Sbjct: 124 VDASP--NGKGKKGFYFREPAGIVSAITPFNFPLNLTAHKIAPSIAAGCPFILKPSERTP 181 Query: 212 VVAAKFVEVLEEAGLPKGVVNFVPGSGTDIGDYLIDHPKTSLITFTGSRDVGVRLYERAA 271 + E+ EAG+P+ V+ +PG D+G + HP +++FTGS VG + ++A Sbjct: 182 LSPIMLCELFLEAGVPEEAVSVIPGYA-DVGQAMTTHPDVRVVSFTGSLKVGEIIAKQAG 240 Query: 272 VVHPGQQHLKRVIVEMGGKDTVVVDKDADLDLAAQSIVTSAFGFSGQKCSAGSRAVIHQD 331 LK++++E+G VVVD+DA+L+LAA+ V F +GQ C + R ++H+D Sbjct: 241 --------LKKIVMELGSNSAVVVDRDANLELAAKKSVLGGFALAGQVCISVQRVLVHED 292 Query: 332 VYDVVLEKAVALTKQLSVGEPTAPDVYMGPVVDQGAFSKIMSYIEVGKEEG-RLMVGGEG 390 V D + +L G+P + +GPV+ ++I S+I+ E+G ++ GG Sbjct: 293 VADRFQKLLKEEVSKLKFGDPMDENTDVGPVIAVDEVNRIQSWIKEAVEKGAKIETGGVS 352 Query: 391 DDSKGFFIQPTIFADVDPHARIMQEEIFGPVVAFSKARDFDHALEIANNTEYGLTGAVIT 450 + QPT+ DV +++ EE F PVV + R D ALE+ N + YGL V T Sbjct: 353 CAEEKTVFQPTVVVDVPEESKLFYEEAFAPVVTVKRFRSIDEALELVNRSNYGLQVGVFT 412 Query: 451 TNRHHIEKAKRDFHVGNLYFNRNCTGAIVGYHPFGGFKMSG 491 N + K +D VG + N T P+GG K SG Sbjct: 413 NNIKNAWKFIQDAEVGGVIINDIPTFR-ADNMPYGGVKGSG 452 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 575 Number of extensions: 29 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 477 Length adjustment: 34 Effective length of query: 481 Effective length of database: 443 Effective search space: 213083 Effective search space used: 213083 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory