Align 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)); 2-keto-3-deoxy-L-rhamnonate dehydrogenase; KDRDH; L-KDR dehydrogenase; L-KDR 4-dehydrogenase; EC 1.1.1.401 (characterized)
to candidate WP_015929521.1 MNOD_RS31260 NAD(P)-dependent oxidoreductase
Query= SwissProt::Q1NEI6 (249 letters) >NCBI__GCF_000022085.1:WP_015929521.1 Length = 248 Score = 303 bits (775), Expect = 3e-87 Identities = 150/246 (60%), Positives = 189/246 (76%) Query: 4 FAGRYAGRCAIVTGGASGLGKQVAARIIAEGGAVALWDLNGDALAATQAEIDATHVVALD 63 +A R+ GR AIVTGGASG+G VAAR+ AEG AV+LWDL+ +AL+ +A A ALD Sbjct: 3 YANRFQGRKAIVTGGASGIGLCVAARLAAEGAAVSLWDLSAEALSQAKAASGAADTQALD 62 Query: 64 VSDHAAVAAAAKDSAAALGKVDILICSAGITGATVPVWEFPVDSFQRVIDINLNGLFYCN 123 V+D A VAAA + S AALG +D+L+CSAGITG V ++PV+++QRVI++NLNGLFYCN Sbjct: 63 VADPARVAAAMQASVAALGGLDVLVCSAGITGPNATVRDYPVEAWQRVIEVNLNGLFYCN 122 Query: 124 REVVPFMLENGYGRIVNLASVAGKEGNPNASAYSASKAGVIGFTKSLGKELAGKGVIANA 183 R VP M GYGRIVN+AS+AGKEGNPNASAYSASKAGVIG TKSLGKELA G+ N Sbjct: 123 RAAVPAMEAGGYGRIVNVASIAGKEGNPNASAYSASKAGVIGLTKSLGKELAQTGIRVNC 182 Query: 184 LTPATFESPILDQLPQSQVDYMRSKIPMGRLGLVEESAAMVCFMASEECSFTTASTFDTS 243 +TPA + I DQ+ Q +++M SKIP+GR G +EE AA++C++ASEE SF+T + FD S Sbjct: 183 VTPAAVRTAIFDQMTQQHIEFMLSKIPLGRFGSIEEIAALICWLASEEASFSTGAVFDLS 242 Query: 244 GGRTTF 249 GGR T+ Sbjct: 243 GGRATY 248 Lambda K H 0.318 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 248 Length adjustment: 24 Effective length of query: 225 Effective length of database: 224 Effective search space: 50400 Effective search space used: 50400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory