Align acetyl-CoA:acetyl-CoA C-acetyltransferase / acetyl-CoA:propanoyl-CoA 2-C-acetyltransferase (EC 2.3.1.9; EC 2.3.1.16) (characterized)
to candidate WP_015930518.1 MNOD_RS18795 acetyl-CoA C-acyltransferase
Query= reanno::pseudo3_N2E3:AO353_25685 (397 letters) >NCBI__GCF_000022085.1:WP_015930518.1 Length = 390 Score = 528 bits (1360), Expect = e-154 Identities = 268/394 (68%), Positives = 320/394 (81%), Gaps = 4/394 (1%) Query: 3 MSHDPIVIVSAVRTPMGGFQGELKSLSAPQLGAAAIRAAVERAGVAADAVEEVLFGCVLS 62 M DP+VI SA RTPMGGF GELK L AP LGAAAIRAAV RAG+ ++ V EV+ GCVL Sbjct: 1 MPFDPVVIASAARTPMGGFGGELKDLPAPALGAAAIRAAVTRAGIDSNDVSEVIMGCVLP 60 Query: 63 AGLGQAPARQAALGAGLDKSTRCTTLNKMCGSGMEAAILAHDMLLAGSADVVVAGGMESM 122 AGLGQAPARQAALGAGL ++T C TLNK+CGSGM+A +L HD+L A SADVVVAGGMESM Sbjct: 61 AGLGQAPARQAALGAGLSEATPCATLNKVCGSGMKAIMLGHDLLRAESADVVVAGGMESM 120 Query: 123 SNAPYLLDRARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEANGFTREAQDE 182 SNAPYLLD+AR+G R+GHG++LDHMFLDGLEDAYDKGRLMG+FAED A+ FTR AQDE Sbjct: 121 SNAPYLLDKARTGQRLGHGRMLDHMFLDGLEDAYDKGRLMGSFAEDTAQHYQFTRIAQDE 180 Query: 183 FAIASTTRAQQAIKDGSFNAEIVPLQVIVGKEQKLITDDEQPPKAKLDKIASLKPAFRDG 242 +A+ S RA+ A + G+F E+VP+QV G+ + DE P KA+ +KI +LKPAFR Sbjct: 181 YALTSLARAKAAQEAGAFADEVVPIQVKGGE----VRADEGPSKARPEKIPTLKPAFRPD 236 Query: 243 GTVTAANSSSISDGAAALLLMRRSEAEKRGLKPLAVIHGHAAFADTPGLFPVAPVGAIKK 302 GT+TAAN+SSISDGAAAL+L R S+AE+RG PLA+I GHA+ A P F AP+GAI K Sbjct: 237 GTITAANASSISDGAAALVLTRLSDAERRGQAPLAIIRGHASHAAAPAWFSTAPIGAITK 296 Query: 303 LLKKTGWSLDEVELFEVNEAFAVVSLVTMTKLEIPHSKVNVHGGACALGHPIGASGARIL 362 LL K GW V+LFE+NEAFAVV++ M L++PH KVNVHGGACALGHPIGASGARI+ Sbjct: 297 LLDKVGWDKGSVDLFEINEAFAVVAMAAMRDLDLPHDKVNVHGGACALGHPIGASGARIV 356 Query: 363 VTLLSALRQKGLKRGVAAICIGGGEATAMAVECL 396 VTLLSAL+Q+GLKRGVA++CIGGGEATA+A+E + Sbjct: 357 VTLLSALKQRGLKRGVASLCIGGGEATALALELI 390 Lambda K H 0.318 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 390 Length adjustment: 31 Effective length of query: 366 Effective length of database: 359 Effective search space: 131394 Effective search space used: 131394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory