Align phosphoserine aminotransferase monomer (EC 2.6.1.52; EC 2.6.1.1) (characterized)
to candidate WP_015933266.1 MNOD_RS32865 phosphoserine transaminase
Query= metacyc::MONOMER-15918 (370 letters) >NCBI__GCF_000022085.1:WP_015933266.1 Length = 399 Score = 435 bits (1118), Expect = e-126 Identities = 211/380 (55%), Positives = 266/380 (70%), Gaps = 12/380 (3%) Query: 2 KPTRVPKNPCFSSGPCAKHPGYSVEELKDTPFGRSHRSKPGKEKLAEAIKRTRDMLGLPD 61 +P P+ PCFSSGPC K PG+ V+ L GRSHRS G+ +L EAI TR +L +P Sbjct: 18 RPEVRPRVPCFSSGPCTKRPGWQVDALSRAVLGRSHRSPLGRSRLKEAIDLTRRVLRVPS 77 Query: 62 DYFVGIVPASDTGAFEMCLWSMLGCRGVDVLVWESFSKGWATDITKQLKLKDTRVFEAEY 121 Y +GIVP SDTGA EM +W+MLG R V+V WE+F W TD K+LK+ + RV +A Y Sbjct: 78 GYRIGIVPGSDTGAVEMAMWTMLGPRAVEVAAWEAFGAEWVTDALKELKI-NPRVHQAPY 136 Query: 122 GKLPDLKKVD-FKNDVVFVWNGTTSGVKVPNADWIPDDREGVTLCDATSAIFAMDIPYHK 180 G LPDL ++D + NDV+F WNGT +GVKVPN DWI DREG+T+CDATSA FA +P+ K Sbjct: 137 GVLPDLSRIDTWHNDVIFTWNGTAAGVKVPNGDWIAADREGITICDATSAAFAQPLPFDK 196 Query: 181 LDVITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTKGGKLNKDIFAGS 240 LDV+TFSWQKV+G E AHG+L+LSPRAV R+ES+TPAWP+PK+FRL K GKL IF G Sbjct: 197 LDVVTFSWQKVMGSEAAHGVLVLSPRAVARIESHTPAWPVPKVFRLAKNGKLIDGIFEGD 256 Query: 241 TINTPSMLANEDWLATLKWAESVGGLKQLIRRTNENLAVFEAFVAKNNWIHFLAETKEIR 300 TINTPSMLA ED+L L+WAES+GGL L R N N V +VA+ WI LA Sbjct: 257 TINTPSMLAVEDYLDALRWAESIGGLDALHARANANAKVIHDWVARTPWITNLAVDSATY 316 Query: 301 SSTSVCFKVDLSD----------EKLKELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATV 350 S+TSVC + D K++++ LE+E+VA+DIG+YRDAP GLRIWCG TV Sbjct: 317 SNTSVCLVITDPDVLARGDAATAALTKDIVEILEREQVAFDIGAYRDAPPGLRIWCGGTV 376 Query: 351 EKEDLECLCEWIEWAYNLVK 370 E++DLE L W++WA++ K Sbjct: 377 ERDDLEALTPWLDWAFSQAK 396 Lambda K H 0.319 0.136 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 399 Length adjustment: 30 Effective length of query: 340 Effective length of database: 369 Effective search space: 125460 Effective search space used: 125460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory