Align sorbitol-6-phosphate dehydrogenase subunit (EC 1.1.1.140) (characterized)
to candidate WP_015942877.1 DHAF_RS03090 KR domain-containing protein
Query= metacyc::MONOMER-13092 (266 letters) >NCBI__GCF_000021925.1:WP_015942877.1 Length = 247 Score = 127 bits (318), Expect = 3e-34 Identities = 85/264 (32%), Positives = 138/264 (52%), Gaps = 34/264 (12%) Query: 8 AGKTVIVTGASSGIGKAIVDELLSLKVKVANFDLTDNGEKH---------ENLLFQKVDV 58 AG+ ++TG + GIG+AIV + + KVA D+ G + E ++ +V Sbjct: 5 AGRVAVITGGAKGIGEAIVRKFYGEEAKVAVLDVDAAGARQLALELDPSGEKVIGLGCNV 64 Query: 59 TSREQVEASVAAVVEHFGTVDAVVNNAGINIPRLLVDPKDPHGQYELDDATFEKITMINQ 118 SRE V+A+ A ++ FGTVD +VNNAGI + +++ + ++ + +N Sbjct: 65 VSREGVKAAFAEIMAKFGTVDILVNNAGITRDAIF---------HKMTEQQWDDVMAVNG 115 Query: 119 KGLYLVSQAVGRLLVAKKKGVIINMASEAGLEGSEGQSAYAGTKAAVYSYTRSWAKELGK 178 KGL+ +Q ++ KK G I N++S G GQ+ Y+ TKA ++T+S A+E G+ Sbjct: 116 KGLFNCTQEAWLIMREKKYGKICNLSS-TNSSGEAGQANYSFTKAGTIAFTKSLAREGGR 174 Query: 179 YGVRVVGIAPGIMEATGLRTLAYEEALGYTRGKTVEEIRAGYASTTTTPLGRSGKLSEVA 238 Y + V + PG+++ +R + E+AL KT R G+ SEVA Sbjct: 175 YNINVNCVRPGVIDTEMMRAVP-EQALEDYINKTA--------------FKRMGQPSEVA 219 Query: 239 DLVAYYISDRSSYITGITTNVAGG 262 D++AY S+ SS++TG VAGG Sbjct: 220 DVIAYLCSEESSFVTGEEILVAGG 243 Lambda K H 0.313 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 247 Length adjustment: 24 Effective length of query: 242 Effective length of database: 223 Effective search space: 53966 Effective search space used: 53966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory