Align D-lactate dehydrogenase (cytochrome) (EC 1.1.2.4) (characterized)
to candidate WP_015942967.1 DHAF_RS03590 FAD-binding oxidoreductase
Query= BRENDA::Q94AX4 (567 letters) >NCBI__GCF_000021925.1:WP_015942967.1 Length = 460 Score = 242 bits (617), Expect = 3e-68 Identities = 135/416 (32%), Positives = 221/416 (53%), Gaps = 6/416 (1%) Query: 149 VVFPRSEEEVSKILKSCNEYKVPIVPYGGATSIEGHTLAPKGGVCIDMSLMKRVKALHVE 208 VV P++ E+V +++K NE+ + ++P G T++ G T+ + V I + M ++ + E Sbjct: 44 VVSPQTTEQVVELVKYLNEHNIKVIPRGAGTNVIGGTIPAEESVVISFTRMNKILEIDTE 103 Query: 209 DMDVIVEPGIGWLELNEYLEEYGLFFPLDPGPG--ASIGGMCATRCSGSLAVRYGTMRDN 266 + +V+PG+ +L LE+ G ++P DP A++GG A G+ +YG RD Sbjct: 104 NFVTVVQPGVVNFDLQLELEKRGFYYPPDPSSAKVATLGGNLAESSGGARCFKYGVTRDY 163 Query: 267 VISLKVVLPNGDVVKTASRARKSAAGYDLTRLIIGSEGTLGVITEITLRLQKIPQHSVVA 326 ++ ++VVLPNG V+ T R KS GYDLTR++ GSEGTLG++T+I LR+ +P + Sbjct: 164 ILGVEVVLPNGKVINTGGRNFKSEPGYDLTRILNGSEGTLGLVTKIILRVLPLPMARRMM 223 Query: 327 VCNFPTVKDAADVAIATMMSGIQVSRVELLDEVQIRAIN--MANGKNLTEAPTLMFEFIG 384 + + V+DAA +GI + +E+LD I G L+ E G Sbjct: 224 LAVYDKVEDAAQTVDGIFAAGIAPATLEMLDNFFINTTEDFCPTGIPRDAGAALIIEIDG 283 Query: 385 TEAYTREQTQIVQQIASKHNGSDFMFAEEPEAKKELWKIRKEALWACYAMAPGHEAMITD 444 EQ +I+ +I K DF A +++ RK + ++ P + I D Sbjct: 284 YPEDMNEQVRIIGEITRKAKARDFKIARSMGEVEQILTPRKVGFGSIASITPSYS--IND 341 Query: 445 VCVPLSHLAELISRSKKELDASSLLCTVIAHAGDGNFHTCIMFDPSSEEQRREAERLNHF 504 + VP S+ ++ + KK ++ V+AHAGDGNFH I++D ++E+ Sbjct: 342 IAVPRSNFSQAFAGIKKIAKDLNVKIGVLAHAGDGNFHPFILYDQRNKEEVERVHAAEQA 401 Query: 505 MVHSALSMDGTCTGEHGVGTGKMKYLEKELGIEALQTMKRIKKTLDPNDIMNPGKL 560 + ALS GT TGE GVG K K+L+K+ EA++ ++IK++ DP + NPGK+ Sbjct: 402 LCEMALSFSGTITGEQGVGIAKRKHLDKQFKPEAMEAFRKIKRSFDPQNRFNPGKI 457 Lambda K H 0.318 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 568 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 567 Length of database: 460 Length adjustment: 35 Effective length of query: 532 Effective length of database: 425 Effective search space: 226100 Effective search space used: 226100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory