Align The Aldohexuronate (glucuronate, galacturonate) uptake porter (characterized)
to candidate WP_015943149.1 DHAF_RS05095 MFS transporter
Query= TCDB::P94774 (345 letters) >NCBI__GCF_000021925.1:WP_015943149.1 Length = 525 Score = 63.5 bits (153), Expect = 1e-14 Identities = 48/168 (28%), Positives = 79/168 (47%), Gaps = 12/168 (7%) Query: 17 IGTVLGYLTRNAIAA----AAPTLQEQLHISTQQYSYIIAAYSACYTIMQPVAGYVLDVL 72 +G +LG T A A P L ++ + + I Y T+ PV G + D + Sbjct: 16 LGLLLGTFTMIEAMAFQIPALPVLTKEFGVPVATAALISLCYYLTATVCGPVFGNIADQI 75 Query: 73 GTKVGYAMFAILWALFCAGTALANSWGGLAVARGAVGMAEAAMIPAGLKASSEWFPAKER 132 G K + I++A+ A A ++ +AR G+ AA++PAGL +S FP +R Sbjct: 76 GRKRIAMIGMIIFAISEFMAAFATNYPFFLLARLCQGIGVAAVLPAGLSYASYLFPPNKR 135 Query: 133 SVAVGYFNV----GSSIGGMLAPPLVVWAIMAHSWQMAFLITGALSLV 176 +AVG + S++GG L L I WQ ++I+G L+++ Sbjct: 136 GIAVGVYTAVGTFASAMGGFLGGIL----IAKFGWQSLYIISGVLAVL 179 Lambda K H 0.327 0.138 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 27 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 525 Length adjustment: 32 Effective length of query: 313 Effective length of database: 493 Effective search space: 154309 Effective search space used: 154309 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory