Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate WP_015943176.1 DHAF_RS05340 C4-dicarboxylate ABC transporter
Query= SwissProt::A3QCW5 (336 letters) >NCBI__GCF_000021925.1:WP_015943176.1 Length = 338 Score = 213 bits (542), Expect = 6e-60 Identities = 117/297 (39%), Positives = 178/297 (59%), Gaps = 4/297 (1%) Query: 36 IKFSHVVAENTPKGQMALKFKQLVEERLPGEYQVNVFPNSQLFGDNNELSALLLNDVQFV 95 IKFSHVVAEN+PKG A +F LV R G +V V+PNS+L+ D E AL ++ + Sbjct: 38 IKFSHVVAENSPKGLAAERFASLVRRRTGGYVEVQVYPNSELYKDGEEFDALKNGAIEMI 97 Query: 96 APSLSKFERYTKKLQLFDLPFLFKDMDAVNRFQQSDAGQQLLNSMKRKGVVGLGYLHNGM 155 AP+ SK + QLFDLP+ F +++ + F GQ LL ++ ++GL HNG Sbjct: 98 APATSKLSAMIPEWQLFDLPYAFNNLENIPYFVDGPVGQMLLARLEEHSMLGLAVWHNGF 157 Query: 156 KQFSASS-PLVLPEDAQGKKFRIMA-SDVLAAQFQAVEAIPVKKPFSEVFTLLQTRAIDG 213 KQ + SS PL PED +G +FRIM S+ L QF+ + A+ FS+V L+T +DG Sbjct: 158 KQMTNSSHPLQRPEDYRGLEFRIMPFSNTLKYQFEVLGAVAHPLAFSDVHAALETGGVDG 217 Query: 214 QENTWSNIYSKKFYEVQSNITESNHGVLDYMVVTSNTFWKSLPADKRKVIKASLDEAIAY 273 +ENT SNI++++F +VQ +T S+HG L Y+V+ + FW+ LP RK+++ +L E + Sbjct: 218 EENTISNIFTQRFDQVQKYLTISDHGYLGYIVIVNKEFWEGLPEGIRKILEEALAEVTLW 277 Query: 274 GNEIAAAKVNKDKQAIIDSK-RSEVTYLTPEQRAAWVNAMKPVWAQFEDKIGKDLID 329 E AA+VN + A ++ + ++ YL E++ A A+ PV+ + IG +L+D Sbjct: 278 ERE-KAAEVNAQQLAALEREGEIKIHYLNAEEQKALEEALAPVYEMLAEDIGTELVD 333 Lambda K H 0.317 0.130 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 338 Length adjustment: 28 Effective length of query: 308 Effective length of database: 310 Effective search space: 95480 Effective search space used: 95480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory