Align acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10); propanal dehydrogenase (CoA-propanoylating) (EC 1.2.1.87) (characterized)
to candidate WP_015943315.1 DHAF_RS06235 acetaldehyde dehydrogenase
Query= BRENDA::Q53WH9 (307 letters) >NCBI__GCF_000021925.1:WP_015943315.1 Length = 297 Score = 328 bits (842), Expect = 7e-95 Identities = 169/297 (56%), Positives = 223/297 (75%), Gaps = 9/297 (3%) Query: 3 ERVKVAILGSGNIGTDLMYKLLKNPGHMELVAVVGIDPKSEGLARARALGLEASHEGIAY 62 +R+ AI+G GNIGTDLMYK+L+ ++EL V GI +SEGL AR G+ S GI Sbjct: 4 QRLNAAIIGPGNIGTDLMYKILRRSEYLELKLVAGIVAESEGLRLAREEGVATSAAGIQA 63 Query: 63 ILERPEIKIVFDATSAKAHVRHAKLLREAGKIAIDLTPAARGPYVVPPVNLKEHLDKDNV 122 IL+R +I IVFDAT+A AH +HA LL++AG IA+DLTPAA GPYV+P VNL+EH+D NV Sbjct: 64 ILDRKDIDIVFDATTAHAHAQHAPLLKDAGIIAVDLTPAAVGPYVMPVVNLEEHIDAMNV 123 Query: 123 NLITCGGQATIPLVYAVHRVAPVLYAEMVSTVASRSAGPGTRQNIDEFTFTTARGLEAIG 182 NLITCGGQATIP+VYA+ RV P YAE+V+T+AS+SAGPGTRQNIDEFT TTA+G+ IG Sbjct: 124 NLITCGGQATIPIVYAISRVVPTAYAEIVATIASKSAGPGTRQNIDEFTLTTAKGIVDIG 183 Query: 183 GAKKGKAIIILNPAEPPILMTNTV-RCIPEDEGFDREAVVASVRAMEREVQAYVPGYRLK 241 A+KGKAII+LNPA+PP++M NT+ I + + + + SV + +EVQA+VPGY+LK Sbjct: 184 NAQKGKAIILLNPADPPMMMNNTIYALIDQVDPAIEQKITESVEEIIKEVQAFVPGYKLK 243 Query: 242 ADPVFERLPTPWGERTVVSMLLEVEGAGDYLPKYAGNLDIMTASARRVGEVFAQHLL 298 P+F+ G + V++++EVEG+GDYLP+Y+GNLD+ T +A V E A+H L Sbjct: 244 IPPMFD------GNK--VTVMIEVEGSGDYLPQYSGNLDLETCAALAVAEKMAKHKL 292 Lambda K H 0.318 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 297 Length adjustment: 27 Effective length of query: 280 Effective length of database: 270 Effective search space: 75600 Effective search space used: 75600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_015943315.1 DHAF_RS06235 (acetaldehyde dehydrogenase)
to HMM TIGR03215 (acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03215.hmm # target sequence database: /tmp/gapView.24781.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03215 [M=285] Accession: TIGR03215 Description: ac_ald_DH_ac: acetaldehyde dehydrogenase (acetylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-135 436.5 6.1 2.6e-135 436.3 6.1 1.0 1 lcl|NCBI__GCF_000021925.1:WP_015943315.1 DHAF_RS06235 acetaldehyde dehydr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021925.1:WP_015943315.1 DHAF_RS06235 acetaldehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 436.3 6.1 2.6e-135 2.6e-135 2 284 .. 6 292 .. 5 293 .. 0.98 Alignments for each domain: == domain 1 score: 436.3 bits; conditional E-value: 2.6e-135 TIGR03215 2 vkvaiiGsGnigtdllikllr.sevlelallvGidpesdGlararelgvetsaeGvdalleeedidivf 69 +++aiiG+Gnigtdl++k+lr se lel+l++Gi +es+Gl+ are gv+tsa G++a+l+++didivf lcl|NCBI__GCF_000021925.1:WP_015943315.1 6 LNAAIIGPGNIGTDLMYKILRrSEYLELKLVAGIVAESEGLRLAREEGVATSAAGIQAILDRKDIDIVF 74 689****************999*********************************************** PP TIGR03215 70 datsakahaenaklleelgkividltPaavGpyvvPavnleevldaknvnlvtCgGqatiPivaavsrv 138 dat+a+aha++a ll+++g+i++dltPaavGpyv+P+vnlee+ da nvnl+tCgGqatiPiv+a+srv lcl|NCBI__GCF_000021925.1:WP_015943315.1 75 DATTAHAHAQHAPLLKDAGIIAVDLTPAAVGPYVMPVVNLEEHIDAMNVNLITCGGQATIPIVYAISRV 143 ********************************************************************* PP TIGR03215 139 akvkyaeivasiasksaGpgtranideftettskaleqvgGakkgkaiiilnPaePpllmrdtvyalve 207 ++ +yaeiva+iasksaGpgtr+nideft tt+k++ +g a+kgkaii+lnPa+Pp++m++t+yal++ lcl|NCBI__GCF_000021925.1:WP_015943315.1 144 VPTAYAEIVATIASKSAGPGTRQNIDEFTLTTAKGIVDIGNAQKGKAIILLNPADPPMMMNNTIYALID 212 ********************************************************************9 PP TIGR03215 208 ead...eeaieasveemveevqkyvpGyrlkqevvldgekvsvlleveGagdylPkyaGnldiltaaal 273 ++d e++i++svee+++evq++vpGy+lk +++dg+kv+v++eveG gdylP+y+Gnld+ t+aal lcl|NCBI__GCF_000021925.1:WP_015943315.1 213 QVDpaiEQKITESVEEIIKEVQAFVPGYKLKIPPMFDGNKVTVMIEVEGSGDYLPQYSGNLDLETCAAL 281 99977789************************************************************* PP TIGR03215 274 avaeklaeell 284 avaek+a++ l lcl|NCBI__GCF_000021925.1:WP_015943315.1 282 AVAEKMAKHKL 292 *******9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.81 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory