Align sorbitol-6-phosphate dehydrogenase (characterized)
to candidate WP_015943847.1 DHAF_RS10450 3-oxoacyl-ACP reductase
Query= CharProtDB::CH_091826 (259 letters) >NCBI__GCF_000021925.1:WP_015943847.1 Length = 253 Score = 135 bits (339), Expect = 1e-36 Identities = 91/255 (35%), Positives = 137/255 (53%), Gaps = 14/255 (5%) Query: 3 QVAVVIGGGQTLGAFLCEGLAQAGYHVAVADLNESNANRLADTINSRYGAGRAYGFKVDA 62 +VAV+ G LG + GLA+ G V + E ++A+ I S+YG +AY F D Sbjct: 7 RVAVITGASSGLGTQMAHGLAEQGADVVLLARREERLRKVAEDIESQYGV-QAYPFPCDV 65 Query: 63 TDEASVEALARAVDETFGRADLLVYSAGVAKAAPITQFRLTDFDLSLQVNLVGYFLCSRE 122 T ASV+A +A E FG+ D+L+ +AG+ AP ++ +L V+L G F +RE Sbjct: 66 TQLASVQAAVQAARERFGKVDILINNAGIGSVAPAETMDDEVWEHNLSVDLTGVFRIARE 125 Query: 123 FSKLMIRDGIKGRIIQINSKSGKVGSKHN--SGYSAAKFGGVGLTQSLALDLAEYGITVH 180 F K+M+ G GRII I+S G VG+ S Y AAK G V LT++LA + A+ G+TV+ Sbjct: 126 FGKVMLEAGY-GRIINISSMYGMVGNSATPASAYHAAKGGVVNLTRALAAEWADRGVTVN 184 Query: 181 SLMLGNLLKSPMFQSLLPQYAEKLGITPEEVEPYYVDKVPLKRGCDYQDVLNVLLFYASD 240 L G ++ + LL EE + Y VPLKR + ++ + F A+D Sbjct: 185 CLCPG-YFETELTVDLL---------KTEEFKAYMERTVPLKRYGNSGELNSAACFLAAD 234 Query: 241 KAAYCTGQSINVTGG 255 +++Y TG + + GG Sbjct: 235 ESSYVTGAILPIDGG 249 Lambda K H 0.319 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 253 Length adjustment: 24 Effective length of query: 235 Effective length of database: 229 Effective search space: 53815 Effective search space used: 53815 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory