Align L-lactaldehyde reductase (EC 1.1.1.77) (characterized)
to candidate WP_015943904.1 DHAF_RS10835 alcohol dehydrogenase
Query= metacyc::STM4044-MONOMER (382 letters) >NCBI__GCF_000021925.1:WP_015943904.1 Length = 405 Score = 227 bits (578), Expect = 5e-64 Identities = 142/371 (38%), Positives = 208/371 (56%), Gaps = 10/371 (2%) Query: 12 LHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMSYHLFDEVFPNP 71 L GA ++ + +++ K K LIVTD + LGL++S LD+ + Y ++D+ PNP Sbjct: 28 LEGANSLNKLPEVISRKGISKILIVTDQGISSLGLVNSFLQDLDKAGVRYTVYDKTVPNP 87 Query: 72 TEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAY-SGVGKVKNAGV 130 T + +++ YQ +C+ I+AFGGGSP+D AK V ANP S + GV KV+ Sbjct: 88 TLDNIEEALKLYQEQQCEGIVAFGGGSPMDCAKGVGARVANPHKSISQMKGVLKVRRKLP 147 Query: 131 PLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVMLEIPASVTAAT 190 PL AI TTAGT +E T AVI D + K + D +IP AV D + + +P +T+ T Sbjct: 148 PLFAIPTTAGTGSEATLAAVISDPRNREKYPVNDTALIPHYAVLDPLLTVGLPKHITSTT 207 Query: 191 GMDALTHAVEAYVSVGAHPLTDANALEAIRLI--NLWLPKAVDDGHNLEAREQMAFGQYL 248 G+DALTHAVEAY+ T + +A+RLI NL++ A G N++ARE M Y Sbjct: 208 GLDALTHAVEAYIGRSNTQETTELSRKAVRLIFDNLYI--AYSQGENVKARENMLKASYY 265 Query: 249 AGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVARFARIAQAMGV 308 AG+AF A +G +HALAH G + +PHG+ NA++LP V + R A +A + + Sbjct: 266 AGVAFTRAYVGYIHALAHALGGFYGVPHGLANAVILPCVLEYYGEAVHERLAELADVLEM 325 Query: 309 ETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKAL--ADPCAPCNP 366 + G S E + I AI+ LSK++ IP G+ EDI ++ A A P P P Sbjct: 326 GSPGDSHEQKATLFIEAIKELSKKMNIPRKID--GILAEDIPLLVEHAWKEATPLYPV-P 382 Query: 367 RTASRDEVRGL 377 R SR+++ + Sbjct: 383 RLLSRNDLNNI 393 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 405 Length adjustment: 31 Effective length of query: 351 Effective length of database: 374 Effective search space: 131274 Effective search space used: 131274 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory