Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19); betaine-aldehyde dehydrogenase (EC 1.2.1.8) (characterized)
to candidate WP_015944133.1 DHAF_RS13220 NAD-dependent succinate-semialdehyde dehydrogenase
Query= BRENDA::Q9STS1 (503 letters) >NCBI__GCF_000021925.1:WP_015944133.1 Length = 479 Score = 288 bits (737), Expect = 3e-82 Identities = 176/486 (36%), Positives = 262/486 (53%), Gaps = 15/486 (3%) Query: 7 RRQLFIGGQWTEPVLRKTLPVVNPATEDIIGYIPAATSEDVELAVEAARKAFTRNNGKDW 66 R LFI G+W E + ++ V+NPAT + I +D AV+AA +AF W Sbjct: 6 RESLFIDGEWQEAINKEVKGVINPATGKVFCEIGYGEVDDALSAVDAADRAFGA-----W 60 Query: 67 ARATGAVRAKYLRAIAAKVIERKSELANLEAIDCGKPLDEAAWDMDDVAGCFEYYADLAE 126 ++ + RA L A + +R + + A + GKP+ +A ++ A F+++A+ Sbjct: 61 SKTSVRERADILNRTADLLRQRADHIGLILAAESGKPVPQAVGEVKFSAEYFQWFAE--- 117 Query: 127 GLDAKQKTPLSLPMDTF--KGYILKEPIGVVGMITPWNYPLLMAVWKVAPSLAAGCTAIL 184 + ++ S+P D + ++ +P GV ++PWN+P+ + K+AP+LAAGCT + Sbjct: 118 --EIRRPYGQSIPSDAANKRHHVYTQPAGVALCLSPWNFPVSIQARKLAPALAAGCTVVA 175 Query: 185 KPSELASLTCLELADICREVGLPPGVLNILTGLGTEAGAPLASHPHVDKIVFTGSTTTGS 244 + SE+A L+ +EL ++ G+P GV N + G A + HP V + FTGST G Sbjct: 176 RGSEVAPLSLIELFKCLQDAGIPKGVANSIQGPAAVTTAAMMKHPAVRVVSFTGSTPVGR 235 Query: 245 SIMTSAAKLVKPVSLELGGKSPIIVFDDVDIDKAVEWTMFGCFWTNGQICSATSRLLVHE 304 S+M AA V ++LELGG +P IVF D DI+KAVE M F NGQ C +R VHE Sbjct: 236 SLMRQAADGVIRLALELGGNAPFIVFADADIEKAVEGAMIAKFRNNGQSCIGANRFYVHE 295 Query: 305 RIADEFLDKLVKWTKNIKISDPFEE-GCRLGPVVSKGQYERVLKFVSNARNEGATVLCGG 363 RI D+F + +KI +P EE LGP+V+ R+ + A GA L Sbjct: 296 RIYDKFTALFAEKILRMKIGNPTEEVDLDLGPMVNLKDKARIESLIREAEALGAKPLV-- 353 Query: 364 VRPEHLKKGYFVEPAIVSNVTTSMEIWREEVFGPALCVKTFSTEDEAIQLANDSQYGLAG 423 + E +GY+V P I+ NV S + REE+F P + F+ E+E I+ AN S GLA Sbjct: 354 PKAEVPAEGYYVPPVILENVPESAALAREELFAPVAPLFKFADENEVIEKANSSDMGLAA 413 Query: 424 AVLSNDLERCDRVSKAFQAGIVWVNCSQPCFCQAPWGGTKRSGFGRELGEWGLENYLSVK 483 V +NDL R RV+++ + GI+ +N + P AP GG K+SG GRE GLE ++ VK Sbjct: 414 YVYTNDLSRSIRVTESLKFGIIGLNNALPSVAYAPMGGVKQSGIGREGARIGLEEFMDVK 473 Query: 484 QVTQYI 489 V I Sbjct: 474 YVATEI 479 Lambda K H 0.318 0.135 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 560 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 503 Length of database: 479 Length adjustment: 34 Effective length of query: 469 Effective length of database: 445 Effective search space: 208705 Effective search space used: 208705 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory