Align Triosephosphate isomerase; TIM; TPI; EC 5.3.1.1; Triose-phosphate isomerase (uncharacterized)
to candidate WP_015944134.1 DHAF_RS13225 triose-phosphate isomerase
Query= curated2:Q3AFD0 (251 letters) >NCBI__GCF_000021925.1:WP_015944134.1 Length = 309 Score = 89.4 bits (220), Expect = 8e-23 Identities = 72/217 (33%), Positives = 103/217 (47%), Gaps = 43/217 (19%) Query: 55 EGSNIALGAQNMHFEKE------GAFTGEVSPAMLQDIGVKYVILGHSE----------- 97 E ++A+G Q + E GAF+ A + + + ++GHSE Sbjct: 73 ERKSLAVGCQGVFREDVVVGGNFGAFSTNRPAAAAKSLNCSWTMIGHSEERNDKMGIIAA 132 Query: 98 -----------RRAYFGETDELINQKIKAAFTWGLNPIFCVGETLEER-------ERGIT 139 R+A D ++NQ++K A GLN +FC+GET E+R ++ Sbjct: 133 YDPGSLHSNMGRQAVNTTVDTILNQELKCALNRGLNVLFCIGETAEDRGDGDFNQQKPPI 192 Query: 140 KAVVEIQVLKGLAGVTAEQAE-NLTIAYEPVWAIGTGKTATPDD-AQEVCQFIRELLVKL 197 KA ++ Q+L GL G Q + L I YEPVWAIG GKT D V +I+E ++ Sbjct: 193 KAALKAQLLNGLKGFDKNQLKGRLVIGYEPVWAIGPGKTPPGSDYIAFVSTYIKETVL-- 250 Query: 198 FGREIADKVRIQYGGSVKPENIKELIAKPD-IDGALV 233 RE + YGG +K EN +IAK D IDG LV Sbjct: 251 --REFNFVPSVVYGGGLKEEN-AGIIAKIDTIDGGLV 284 Lambda K H 0.318 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 309 Length adjustment: 25 Effective length of query: 226 Effective length of database: 284 Effective search space: 64184 Effective search space used: 64184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory