Align L-ribulose-5-phosphate 4-epimerase UlaF; L-ascorbate utilization protein F; Phosphoribulose isomerase; EC 5.1.3.4 (characterized)
to candidate WP_015944767.1 DHAF_RS18790 aldolase
Query= SwissProt::P39306 (228 letters) >NCBI__GCF_000021925.1:WP_015944767.1 Length = 212 Score = 96.3 bits (238), Expect = 4e-25 Identities = 67/222 (30%), Positives = 110/222 (49%), Gaps = 13/222 (5%) Query: 4 LKQQVFEANMELPRYGLVTFTWGNVSAIDRERGLVVIKPSGVAYETMKAADMVVVDMSGK 63 LK+++ E ++ + G+V TWGN+SA D +R I PSG+ Y ++K D+V++ M Sbjct: 2 LKEKILEIGQKIAQSGMVAGTWGNISAWDSDRNGYWITPSGMDYFSLKEEDLVLLSMDNT 61 Query: 64 VVEGEYRPSSDTATHLELYRRYPSLGGIVHTHSTHATAWAQAGLAIPALGTTHADYFFGD 123 V+EG+ +PSS+ H ++Y++ P + GIVHTHS ATA A + L +P + G Sbjct: 62 VLEGKRKPSSELLLHGQIYKQRPDVKGIVHTHSPFATAHAVSRLPLPGIVEDLVMIAGGQ 121 Query: 124 IPCTRGLSEEEVQGEYELNTGKVIIETLGNAEPLHTPGIVVYQHGPFAWGKDAHDAVHNA 183 + R E+ G EL V NA + + HG G +A Sbjct: 122 VAVAR----YELPGTLELALSAVQALEDKNA-------VFLANHGLVGVGFSLAEAFKVC 170 Query: 184 VVMEEVAKMAWIAR--GINPQLNHIDSFLMNKHFMRKHGPNA 223 V+E+ A++ ++R G L+ D +M + + +G A Sbjct: 171 QVVEKSAQIHIMSRLLGKPAALSPEDIQIMRRAYQESYGQRA 212 Lambda K H 0.318 0.134 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 212 Length adjustment: 22 Effective length of query: 206 Effective length of database: 190 Effective search space: 39140 Effective search space used: 39140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory