Align glucokinase; EC 2.7.1.2 (characterized)
to candidate WP_015945030.1 DHAF_RS20520 ROK family transcriptional regulator
Query= CharProtDB::CH_014478 (324 letters) >NCBI__GCF_000021925.1:WP_015945030.1 Length = 406 Score = 127 bits (319), Expect = 5e-34 Identities = 82/267 (30%), Positives = 130/267 (48%), Gaps = 10/267 (3%) Query: 7 WLVGVDLGGTTIKMAFINHYGEIIHKWEINTDVSEQGRKIPTDIAKAIDKKLNDLGEVKS 66 +++G+D+ ++ N E+I K + D + + I I + + G Sbjct: 86 YVIGIDISRLYSQVVLTNLKMELIEKDRFDMDRNSSPQATLNRILDWIGRVMEKRGH--G 143 Query: 67 RLVGIGIGAPGPVNFANGSIEVAVNL---GWEKFPIKDILEVETSLPVVVDNDANIAAIG 123 ++G+GIG GP++ +G I N GWE P+K I+E T LPV++DN AN A + Sbjct: 144 YVIGVGIGTVGPLDRQSGIILNPENFEAQGWENIPLKAIVEERTGLPVIIDNGANGAVLA 203 Query: 124 EMWKGAGDGAKDLLCVTLGTGVGGGVIANGEIVQGVNGAAGEIGHITSIPEGGAPCNCGK 183 E G+G G K ++ + G G+ GVI++G +V+ +N A H+ I G PC+CG Sbjct: 204 ETRYGSGKGMKSVIYLNCGVGIRTGVISSGTLVRTINDADDTFAHMV-IDVNGKPCHCGN 262 Query: 184 TGCLETIASATGIVRLTMEELTETDKPSELRTVLEQNGQVTSKDVFDAARSKDGLAMHVV 243 GC+E +S I ME L E + R + + V+ ++ A D +A V+ Sbjct: 263 QGCVERYSSIYAI----MEALAEEMPQGKDRRNHKADRPVSYLELCREAEENDTIARQVL 318 Query: 244 DKVAFHLGLALANSANALNPEKIVLGG 270 A +G LAN LNP +VL G Sbjct: 319 QNAAVRMGTGLANFIQLLNPGLVVLSG 345 Lambda K H 0.316 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 406 Length adjustment: 29 Effective length of query: 295 Effective length of database: 377 Effective search space: 111215 Effective search space used: 111215 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory