Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_015945291.1 DHAF_RS22655 enoyl-CoA hydratase/isomerase family protein
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_000021925.1:WP_015945291.1 Length = 261 Score = 149 bits (375), Expect = 7e-41 Identities = 97/255 (38%), Positives = 132/255 (51%), Gaps = 19/255 (7%) Query: 14 VRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGSR-KAFAAGADIKEMAE 72 + L+TL RP N+ E+ D E R V+ TG+ K F AGAD+ +A+ Sbjct: 15 IALVTLNRPHKGNSWTLDTYQEMEKIQEDLHYDDEVRVVIFTGAGDKFFCAGADLSLLAK 74 Query: 73 -------RDLV---GILEDPRVAHWQRIAAFSKPLIAAVNGFCLGGGCELAMHADILIAG 122 RDL GI W R F KP+I A+NG +G G ELA+ DI IA Sbjct: 75 LTPHFISRDLYRYQGIN-----TRWDR---FIKPVIMAINGITVGSGLELALCGDIRIAS 126 Query: 123 EDARFGQPEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRAGLVSEVTLP 182 + F E+ +G+ P GGTQRL R VG S A +++ + + IDA+ A R GLV + P Sbjct: 127 SSSLFSINEVRIGLNPDMGGTQRLTRTVGPSQAKRLIFTAERIDAQEAARIGLVDILVEP 186 Query: 183 ELTIERALAIARVIAQKAPLAVRLAKEALLKAEDTDLASGLRFERHAFTVLAGTADRAEG 242 E + AL +A IA P A+R AK+A+ A D L GL +E T GT D+ E Sbjct: 187 ENLLNEALKMAEQIASMPPYAIRFAKKAINLAVDAPLEIGLMYEEAGSTFCMGTEDKKEA 246 Query: 243 IRAFQEKRRPEFTGR 257 + + EKR+P+F GR Sbjct: 247 VDSILEKRQPKFHGR 261 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 261 Length adjustment: 24 Effective length of query: 233 Effective length of database: 237 Effective search space: 55221 Effective search space used: 55221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory