Align alpha-ketoglutarate TRAP transporter, solute receptor component (characterized)
to candidate WP_015945367.1 DHAF_RS23180 C4-dicarboxylate ABC transporter
Query= reanno::SB2B:6938088 (339 letters) >NCBI__GCF_000021925.1:WP_015945367.1 Length = 343 Score = 221 bits (562), Expect = 3e-62 Identities = 115/299 (38%), Positives = 177/299 (59%), Gaps = 3/299 (1%) Query: 34 EPVEIKFSHVVAENTPKGQMALKFKELVESRLPGEYKVSVFPNSQLFGDNNELAALLLND 93 + + IKFSHVV ENTPKG A++F LV R G +V FPNSQLF D E AL D Sbjct: 34 DKIIIKFSHVVEENTPKGLAAIRFANLVRERSKGIIEVQAFPNSQLFKDGEEFEALSRGD 93 Query: 94 VQLVAPSLSKFERYTKKLQVFDLPFLFEDMDAVDRFQQSEAGQQLLNSMSRKGLVGLGYL 153 VQ++AP+ SK + + Q++DLP+LF+D+D+V + G+ LL+ + +K + GL Sbjct: 94 VQMIAPTTSKVAQLFPQWQIWDLPYLFDDLDSVHQIMDGPLGKTLLDQLHQKNMKGLAMW 153 Query: 154 HNGMKQFSAN-NALSLPGDAAGKKFRIMPSDVIAAQFEAVGAIPVKKPFSEVFTLLQTRA 212 NG K + N + ++ PGD G FRIM ++ QF + GA + PF++V+ L+ Sbjct: 154 DNGFKHLTNNDHPITKPGDLKGLTFRIMSQGILEEQFHSFGAATLYLPFNDVYQSLEEGR 213 Query: 213 IDGQENTWSNIYSKKFYEVQTHITESNHGVLDYMLVTSETFWKSLPKDKREIIKQSMDEA 272 GQENT SNIY+K F +VQ+++T S HG + Y ++ +E FW LP RE+++++M E Sbjct: 214 AQGQENTISNIYTKNFDQVQSYLTLSQHGFMGYAVMVNEDFWNQLPAQARELLEETMAEV 273 Query: 273 VALGNKLALEKANEDRQLILDSK-RVELVTLTPEQRQAWVNAMRPVWSQFEDKIGKDLI 330 +A +K NE++ L + ++++ TL E+R W V+++F K G D + Sbjct: 274 TQWERDIA-QKLNEEQLRELQKRNQIKIYTLNNEERNIWQEDFALVYAKFAQKCGTDFL 331 Lambda K H 0.316 0.132 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 343 Length adjustment: 29 Effective length of query: 310 Effective length of database: 314 Effective search space: 97340 Effective search space used: 97340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory