Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_015945417.1 DHAF_RS23530 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000021925.1:WP_015945417.1 Length = 395 Score = 439 bits (1128), Expect = e-127 Identities = 222/395 (56%), Positives = 293/395 (74%), Gaps = 5/395 (1%) Query: 1 MEKMTIRDVDLKGKRVIMRVDFNVPVKD-GVVQDDTRIRAALPTIKYALEQGAKVILLSH 59 M K ++D+ ++GKRV +RVDFNVP+ D G + +DTRIRAALPTI Y +++GAK+IL SH Sbjct: 2 MNKKGLKDIAVQGKRVFVRVDFNVPMDDHGNITNDTRIRAALPTIHYLIDEGAKIILASH 61 Query: 60 LGRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRF 119 LGRPKG+P P +SLAPVAKRL ELL + V +G EV+KA +L+EGEVLLLEN R+ Sbjct: 62 LGRPKGKPDPNYSLAPVAKRLGELLKRPVAMATDCIGPEVEKAAAQLQEGEVLLLENVRY 121 Query: 120 HPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLS 179 H E KN+PE K A LA+++VNDAFGTAHRAHAS GIA +P VAGFL++KEI+ + Sbjct: 122 HAEEEKNEPEFVKQLARLAEVYVNDAFGTAHRAHASTEGIAHHLPGVAGFLLQKEIESMG 181 Query: 180 KVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVE 239 K NPE+P+V ++GGAKVSDKIGVI NL+ K D ++IGG M TFLKA G +G S VE Sbjct: 182 KALENPERPFVAIIGGAKVSDKIGVIENLLHKVDALIIGGGMANTFLKAQGYSLGKSLVE 241 Query: 240 EDKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPE 299 DK+ LA+E+LE+ +E V+I+LP D V A++ + +V + + I E M LDIGPE Sbjct: 242 GDKLSLAQEILEQGRELQVDILLPQDVVAAKEFKADAPYRVTPVRE-IAEDEMALDIGPE 300 Query: 300 TIELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAA 359 + LF ++ A+T+VWNGPMGVFE++ FA+GT++VA A+A +T+VGGGDS AA Sbjct: 301 SAGLFSARIQKARTIVWNGPMGVFEMEQFAKGTEKVAQAVALCP---GLTIVGGGDSVAA 357 Query: 360 VNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASI 394 V K G+ ++ SH+STGGGASL+ LEGK LPGIA++ Sbjct: 358 VEKMGVGEQMSHISTGGGASLKLLEGKTLPGIAAL 392 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 699 Number of extensions: 37 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 395 Length adjustment: 34 Effective length of query: 620 Effective length of database: 361 Effective search space: 223820 Effective search space used: 223820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory