Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (characterized)
to candidate WP_015948094.1 G491_RS0110705 crotonase
Query= SwissProt::P94549 (258 letters) >NCBI__GCF_000429905.1:WP_015948094.1 Length = 261 Score = 185 bits (469), Expect = 9e-52 Identities = 110/249 (44%), Positives = 148/249 (59%), Gaps = 5/249 (2%) Query: 12 VAVLTIHNPPA-NALSSRILEELSSCLDQCETDAGVRSIIIHGEG-RFFSAGADIKEFTS 69 +AV+TI P NA+ + E+ LD E D +R ++I G G + F +G DI Sbjct: 14 IAVITIDRPKVLNAIRYVTMLEIDKALDDIEEDESIRVLVITGAGDKAFISGGDISIMAR 73 Query: 70 LKGNEDSSLLAERGQQLMERIESFPKPIIAAIHGAALGGGLELAMACHIRIAAEDAKLGL 129 +G ++ +GQ + RIE FPKP+IA I+G ALGGG E+A++C IRIA E A +GL Sbjct: 74 GRGYVETLTETPKGQAVCTRIEHFPKPVIARINGFALGGGTEVALSCDIRIAVEHAIMGL 133 Query: 130 PELNLGIIPGFAGTQRLPRYVGTAKALELIGSGEPISGKEALDLGLVS-IGAKDEAEVIE 188 PE+ LGIIPG+ GTQRLPR VG KA ELI +G+ IS EAL++GLV+ + K+E +V+ Sbjct: 134 PEIKLGIIPGYGGTQRLPRLVGMGKAKELIMTGDHISAMEALNIGLVNHVVPKEELDVL- 192 Query: 189 KAKALAAKFAEKSPQTLASLLELLYSNKVYSYEGSLKLEAKRFGEAFESEDAKEGIQAFL 248 +A K A KSP L + + L EA+ F F SED EG AF+ Sbjct: 193 -VSKMAGKIASKSPIALHMAKASINNGVQADLRTGLDYEARCFSLCFGSEDRVEGTNAFM 251 Query: 249 EKRKPQFKG 257 EKRKP+F G Sbjct: 252 EKRKPKFTG 260 Lambda K H 0.315 0.134 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 261 Length adjustment: 24 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory