Align Fructokinase; D-fructose kinase; Manno(fructo)kinase; EC 2.7.1.4 (characterized)
to candidate WP_017364198.1 MCA_RS03265 fructokinase
Query= SwissProt::P23917 (302 letters) >NCBI__GCF_000008325.1:WP_017364198.1 Length = 300 Score = 312 bits (800), Expect = 5e-90 Identities = 159/297 (53%), Positives = 199/297 (67%), Gaps = 3/297 (1%) Query: 3 IGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVDMAEQATGQRGTVGM 62 +GIDLGGTK E+IA+ G +L R R TP+ +Y +TI TI LV+ AE +RGTVG+ Sbjct: 5 LGIDLGGTKVELIAMTSHGRELLRRRTDTPQGNYPETIRTIVRLVEEAEYELAERGTVGI 64 Query: 63 GIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAAGA 122 G PG++S TG +KN+NS LNG P +DL+ L R VRLANDA+C A+SEAVDGAAA A Sbjct: 65 GTPGAVSAATGRLKNSNSVCLNGMPLREDLARALGRPVRLANDADCFALSEAVDGAAARA 124 Query: 123 QTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCYCGKQG 182 ++VF VI+GTG G G+ GR G N AGEWGHNPLPW E R PCYCGK G Sbjct: 125 ESVFGVILGTGVGGGIVIRGRLLNGANAIAGEWGHNPLPWPQGIE---RPGPPCYCGKSG 181 Query: 183 CIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKSLAHVVNI 242 CIETF+SG G A D+ R +G +L I E ++ YE RLA++LAHV+NI Sbjct: 182 CIETFLSGPGLARDHERRTGESLDAKSIAERAELGHASCRGSMALYEDRLARALAHVINI 241 Query: 243 LDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPVRKAKHGDSSGVRGAAWLW 299 +DP VIVLGGG+SN RLY V +L ++VF +T + ++GDSSGVRGAAWLW Sbjct: 242 VDPHVIVLGGGLSNCARLYANVPRLWGRYVFSDRVDTRLVPPRYGDSSGVRGAAWLW 298 Lambda K H 0.318 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 300 Length adjustment: 27 Effective length of query: 275 Effective length of database: 273 Effective search space: 75075 Effective search space used: 75075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory