Align Homogentisate 1,2-dioxygenase (EC 1.13.11.5) (characterized)
to candidate WP_017598884.1 D471_RS0112260 homogentisate 1,2-dioxygenase
Query= reanno::MR1:201124 (386 letters) >NCBI__GCF_000341125.1:WP_017598884.1 Length = 401 Score = 287 bits (734), Expect = 4e-82 Identities = 156/385 (40%), Positives = 220/385 (57%), Gaps = 21/385 (5%) Query: 1 MPFYVKQGQVPHKRHIAFEKENGELYREELFSTHGFSNIYSNKYHHNMPTKALEVAPYRL 60 M Y + G+VP RH +G LY EEL GFS+ S YH +P+ ++ A + L Sbjct: 1 MAHYRRVGEVPRTRHTQHRNPDGGLYYEELMGEEGFSSDSSLLYHRAIPSAIVDAAEWEL 60 Query: 61 GHGAHWEDS--LVQNYKLDSRSADRE---GNFFSARNKIFYNNDVAIYTAKVTQDTAEFY 115 ++ + ++ KL S AD++ + +R + N+DV + + V +E Y Sbjct: 61 PDLTRTRNAPMVPRHLKLHSLFADQDWKAADVVESRRLVLGNDDVRL-SYVVAGAPSELY 119 Query: 116 RNAYADEVVFVHEGEGTLYSEYGTLEIKKWDYLVIPRGTTHQLKFNNYSNVRLFVIEAFS 175 RN DE V+V G+ + + +G L++ + DY+++PR TTH+ +R +V+EA S Sbjct: 120 RNGIGDECVYVESGQARVETVFGALDVGRGDYVILPRATTHRWVPTGDGPLRAYVVEANS 179 Query: 176 MVEVPKHCRNEYGQLLESAPYCERDLRTPI---------LQAAVVERGAFPLVCKFGDKY 226 + PK + YGQ LE APYCERDLR P + + RG P G +Y Sbjct: 180 HIAPPKRYLSRYGQFLEHAPYCERDLRGPEEPLLAEGENVDVLIKHRGDGPGGIS-GTRY 238 Query: 227 QLTTLEWHPFDLVGWDGCVYPWAFNITEYAPKVGKIHLPPSDHLVFTAHNFVVCNFVPRP 286 T HPFD+VGWDGC+YP+ FN+ ++ P G++H PP H VF HNFV+CNFVPR Sbjct: 239 TCPT---HPFDVVGWDGCLYPYVFNVDDFQPITGRVHQPPPVHQVFEGHNFVICNFVPRK 295 Query: 287 YDFHERAIPAPYYHNNIDSDEVLYYVDGDFMSR--TGIEAGYITLHQKGVAHGPQPGRTE 344 D+H +IP PYYH+N+DSDEV++Y GD+ +R +GI G I+LH G +HGPQPG E Sbjct: 296 VDYHPESIPVPYYHSNVDSDEVMFYCGGDYEARKGSGIGQGSISLHPGGHSHGPQPGAYE 355 Query: 345 ASIGKKETYEYAVMVDTFAPLKLTE 369 S+G E AVMVDTF PL L E Sbjct: 356 RSVGVHYFDELAVMVDTFRPLDLGE 380 Lambda K H 0.321 0.137 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 557 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 401 Length adjustment: 31 Effective length of query: 355 Effective length of database: 370 Effective search space: 131350 Effective search space used: 131350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory