Align 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase; EC 2.3.1.174; EC 2.3.1.223 (characterized)
to candidate WP_017599812.1 D471_RS0117455 acetyl-CoA C-acyltransferase
Query= SwissProt::P0C7L2 (401 letters) >NCBI__GCF_000341125.1:WP_017599812.1 Length = 402 Score = 390 bits (1002), Expect = e-113 Identities = 214/402 (53%), Positives = 276/402 (68%), Gaps = 6/402 (1%) Query: 2 REAFICDGIRTPIGRYGGALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQAG 61 R+ ++ D +RTP+GRY GAL++VR DDLAA +R LL R P LD + I DV LG AN AG Sbjct: 4 RDVYVVDAVRTPVGRYDGALAAVRPDDLAAHTVRALLERTPDLDPDRIGDVYLGNANGAG 63 Query: 62 EDNRNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESMS 121 E+NRNV RMA LLAGLP SV G T+NRLC SGL+A+ AARAI GD +L+AGGVESM+ Sbjct: 64 EENRNVGRMAALLAGLPTSVPGVTVNRLCASGLEAVVQAARAIALGDASVLVAGGVESMT 123 Query: 122 RAPFVMGKAASAF-SRQAEMFDTTIGWRFVNPLMAQQFGTDSMPETAENVAELLKISRED 180 RAP+V+ K+ AF + AE++ TT+GWR VNP M ++ T + E+AE +A+ I+RE Sbjct: 124 RAPYVLPKSDRAFPAGHAELYSTTLGWRMVNPAMEPRW-TVPLGESAELIADEHGITRER 182 Query: 181 QDSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHLRPETTLEQLRGLKA 240 QD FAL S + A AQ G+ E VPV + ++G + DE +RP+ +LE + L+ Sbjct: 183 QDEFALESHLKAAAAQEQGLFDAETVPVRVPRRRGGAVTVDRDEGVRPDASLEAMARLRP 242 Query: 241 PFRA-NGVITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAMATAGVEPRLMGLGP 299 FRA +G +TAGNAS ++DGAAAL++A E+ A G P ARI A A + VEP GLGP Sbjct: 243 SFRAEDGTVTAGNASPLSDGAAALLLADEEGVRATGRAPLARISASAVSAVEPHWFGLGP 302 Query: 300 VPATRRVLERAGLSIHDMDVIELNEAFAAQALGVLRELGLPD-DAPHVNPNGGAIALGHP 358 V A R L RAG S+ D+DV+ELNEAFAAQ LG L E P+ D +NP GGAIALGHP Sbjct: 303 VEAVNRALSRAGRSLTDVDVLELNEAFAAQVLGCLAE--WPEFDRAVLNPLGGAIALGHP 360 Query: 359 LGMSGARLALAASHELHRRNGRYALCTMCIGVGQGIAMILER 400 LG SGARLA +H+L R + +C+GVGQG+A++LER Sbjct: 361 LGASGARLAGTVAHQLARAGSGTGVAALCVGVGQGLALVLER 402 Lambda K H 0.319 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 402 Length adjustment: 31 Effective length of query: 370 Effective length of database: 371 Effective search space: 137270 Effective search space used: 137270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory