Align ring 1,2-phenylacetyl-CoA epoxidase PaaE subunit (EC 1.14.13.149) (characterized)
to candidate WP_017600835.1 D471_RS0123220 phenylacetate-CoA oxygenase/reductase subunit PaaK
Query= metacyc::MONOMER-15950 (357 letters) >NCBI__GCF_000341125.1:WP_017600835.1 Length = 365 Score = 270 bits (690), Expect = 4e-77 Identities = 146/353 (41%), Positives = 207/353 (58%), Gaps = 6/353 (1%) Query: 4 FHSLTIKEVRPETRDAVSIAFDVPAELADSFRFTQGQHLVMRTQLDGEEVRRSYSICTGV 63 FH L + +V DAV++ FDVP LA+ + F GQ L +R +DG E RRSYS+C+ V Sbjct: 17 FHRLRVADVERLCDDAVAVTFDVPDHLAEEYAFAPGQSLTLRRVVDGVEERRSYSVCSAV 76 Query: 64 NDGELRVAIKRVAGGRFSAYANESLKAGQRLEVMPPSGHFHVELDAARHGNYLAVAAGSG 123 RV ++ V GG FSA+ ++ G+ +EV P+G F +L + G ++ +AAGSG Sbjct: 77 GQAP-RVGVRLVPGGLFSAWLVNEVRPGEEIEVGAPTGRFCPDLTTS--GRHVMIAAGSG 133 Query: 124 ITPILSIIKTTLETEPHSRVTLLYGNRSSASTLFREQLEDLKNRYLQRLNLIFLFSREQQ 183 ITP+LS+ + L S V LLYGNR S + +F ++L DLK+ + R L+ + SRE + Sbjct: 134 ITPMLSMAASLLRATD-SHVVLLYGNRRSDTVMFADELADLKDAFGSRFELVHVLSREPR 192 Query: 184 DVDLYNGRIDADKCGQLFSRWIDVKALDAAFICGPQAMTETVRDQLKANGMAAERIHFEL 243 + +L+ GR+DA K QL + A D ++CGP M R L+ G+ ERIH EL Sbjct: 193 EAELFTGRLDAAKLEQLLDTIVAADAADHWWLCGPYGMVTDARGVLRGRGVPGERIHQEL 252 Query: 244 FAAAGSAQKREAR-ESAAQDSSVSQITVISDGRELSFELPRNSQSILDAGNAQGAELPYS 302 F G ++R E + S++TV+ DGR + LPR +LDA +LP++ Sbjct: 253 FFVEGDEPPPQSRHEEPGVEGPSSEVTVVLDGRTTTLTLPR-GVPVLDAAQCYRPDLPFA 311 Query: 303 CKAGVCSTCKCKVVEGEVEMDSNFALEDYEVAAGYVLSCQTFPISDKVVLDFD 355 CK GVC TC+ KV +GEV M N+AL + EV AGY LSCQ P +D V +DFD Sbjct: 312 CKGGVCGTCRVKVCDGEVSMRRNYALSEEEVEAGYALSCQALPETDAVTVDFD 364 Lambda K H 0.319 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 365 Length adjustment: 29 Effective length of query: 328 Effective length of database: 336 Effective search space: 110208 Effective search space used: 110208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory