Align β-glycosidase (β-gly) (EC 3.2.1.21|3.2.1.23) (characterized)
to candidate WP_017601152.1 D471_RS0125015 hypothetical protein
Query= CAZy::ABI35984.1 (431 letters) >NCBI__GCF_000341125.1:WP_017601152.1 Length = 331 Score = 261 bits (666), Expect = 3e-74 Identities = 157/315 (49%), Positives = 188/315 (59%), Gaps = 23/315 (7%) Query: 136 ETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHL 195 +TA FAEYA VA L DRV + TLNEP+CSAFLGH G HAPG R AL AAHHL Sbjct: 1 DTAHRFAEYARVVADRLGDRVHRWITLNEPFCSAFLGHAVGRHAPGTREGTPALAAAHHL 60 Query: 196 LLGHGLAVEALRAAGARRVGIVLN---FAPAYGEDPE--AVDVADRYHNRYFLDPILGKG 250 LL HGLAV LRAA +VGI LN PA G + + AV+ A HNR +LDPIL Sbjct: 61 LLAHGLAVRELRAAAPGQVGITLNPDHLLPATGSEADRAAVERARTLHNRVWLDPILTGA 120 Query: 251 YPESPFRDPPPVPILSR----DLELVARPLDFLGVNYYAPVRV--APGTGTLPVR----- 299 YP++ P+ S DL+++ RPLDFLG+NYY P+++ AP P R Sbjct: 121 YPDNEEETWGPLADGSYRAEGDLDVIGRPLDFLGINYYRPIKLRDAPRNEADPARRTAAD 180 Query: 300 ----YLPPEGPA-TAMGWEVYPEGLHHLLKRLGREVPW--PLYVTENGAAYPDLWTGEAV 352 +P E T MGW V P+ L LL L R P P+ +TENG+A D G Sbjct: 181 IGVEQVPFEDVRHTTMGWPVLPDTLTDLLVDLDRRYPGLPPVLITENGSAEDDRPDGSGR 240 Query: 353 VEDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVDFPSQR 412 V D ERV YL AH+ A RA + GVD+RGYFVWSL+DNFEWA GY RRFGL VD+ + Sbjct: 241 VRDRERVDYLRAHLAALSRALDAGVDVRGYFVWSLLDNFEWAHGYDRRFGLVRVDYETLE 300 Query: 413 RIPKRSALWYRERIA 427 R PK S WYR+ +A Sbjct: 301 RHPKDSYRWYRDFLA 315 Lambda K H 0.322 0.140 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 450 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 331 Length adjustment: 30 Effective length of query: 401 Effective length of database: 301 Effective search space: 120701 Effective search space used: 120701 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory