Align 3-methyl-2-oxobutanoate dehydrogenase subunit alpha; Branched-chain alpha-ketoacid dehydrogenase E1 component subunit alpha; BCKADH E1-alpha; EC 1.2.4.4 (characterized)
to candidate WP_017601258.1 D471_RS0125590 pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
Query= SwissProt::P9WIS3 (367 letters) >NCBI__GCF_000341125.1:WP_017601258.1 Length = 371 Score = 288 bits (736), Expect = 2e-82 Identities = 163/353 (46%), Positives = 209/353 (59%), Gaps = 5/353 (1%) Query: 16 DLEPVQLVGPDGTPTAERRYHRDLPEETLRWLYEMMVVTRELDTEFVNLQRQGELALYTP 75 + E VQL+ P+G TA Y D+ + +R LY +V+ R +D+E V+LQRQGEL L+ Sbjct: 9 ETELVQLLTPEGEFTAHPDYPLDIGADEIRDLYRDLVLVRRVDSEAVSLQRQGELGLWAS 68 Query: 76 CRGQEAAQVGAAACLRKTDWLFPQYRELGVYLVRGIPPGHVGVAWRGTWHGGLQFTTKCC 135 GQEAAQ+G+ LR D FP YRE GV RGI P + +RG +GG Sbjct: 69 LLGQEAAQIGSGRALRDGDMAFPSYREHGVAWCRGIEPKELLGMFRGVTNGGWDPHEHGF 128 Query: 136 APMSVPIGTQTLHAVGAAMAAQR---LDEDSVTV-AFLGDGATSEGDVHEALNFAAVFTT 191 ++ IG+Q LHA G AM QR + ED V A+ GDGATS+GD +EA NFA+V Sbjct: 129 HLYTIVIGSQALHATGYAMGVQRDGAVGEDGTAVIAYFGDGATSQGDTNEAFNFASVNNA 188 Query: 192 PCVFYVQNNQWAISMPVSRQTAAPSIAHKAIGYGMPGIRVDGNDVLACYAVMAEAAARAR 251 P VF+ QNNQWAIS P+ RQ P I +A G+G PG+RVDGNDVLAC AV A AR Sbjct: 189 PVVFFCQNNQWAISEPLERQARVP-IYRRASGFGFPGVRVDGNDVLACLAVTRAALTNAR 247 Query: 252 AGDGPTLIEAVTYRLGPHTTADDPTRYRSQEEVDRWATLDPIPRYRTYLQDQGLWSQRLE 311 G+GPTL+EA TYR+G HTT DDPTRYR+ E+D W DPI R R +L+ +GL + Sbjct: 248 EGNGPTLVEAFTYRMGAHTTNDDPTRYRATAELDEWKAKDPILRLRRHLEREGLADEEFF 307 Query: 312 EQVTARAKHVRSELRDAVFDAPDFDVDEVFTTVYAEITPGLQAQREQLRAELA 364 V A A + +R PD + ++F VYAE + QR + LA Sbjct: 308 ASVDAEADAIGERVRAECRALPDPEPLDIFHEVYAEPNVHIDQQRSEFAEYLA 360 Lambda K H 0.320 0.134 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 371 Length adjustment: 30 Effective length of query: 337 Effective length of database: 341 Effective search space: 114917 Effective search space used: 114917 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory