Align lactaldehyde dehydrogenase (EC 1.2.1.22); D-glyceraldehyde dehydrogenase (NADP+) (EC 1.2.1.89) (characterized)
to candidate WP_017601549.1 D471_RS0127260 aldehyde dehydrogenase
Query= BRENDA::P25553 (479 letters) >NCBI__GCF_000341125.1:WP_017601549.1 Length = 458 Score = 295 bits (754), Expect = 3e-84 Identities = 170/452 (37%), Positives = 250/452 (55%), Gaps = 7/452 (1%) Query: 26 VVNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERASWLRKISAGIRERASE 85 VV+PATEAVI+ +P ++ A++ A A P W A+ +RA LR ++A I + E Sbjct: 10 VVDPATEAVIAEVPLAGEKEVDAAVERARAAAPAWRAMAPGDRARLLRAVAARIDQHREE 69 Query: 86 ISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQSDRPGENILLFKRALGV 145 ++ V G + A E D +Y A R G Q PG + F LGV Sbjct: 70 LARTEVRNAGHPVEQARWEAGNARDVFEYFAAAPERATGR--QIPVPGGWSVTFAEPLGV 127 Query: 146 TTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIGLPRGVFNLV 205 I+PWNFP +++ APAL GNT+V+KPSE TP A+ A++ E GLP GVF +V Sbjct: 128 VGVIVPWNFPMPVLSWGAAPALAAGNTVVVKPSELTPLTALRIAELALEAGLPEGVFQVV 187 Query: 206 LGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMATAAKNITKVCLELGGKAPAIVMDDAD 265 G G G+ L +P V V TGS + G +IM AA++ T+V LELGGK+ +V DAD Sbjct: 188 PGTGPVAGERLVRHPGVDKVVFTGSTAVGRRIMTAAAEDFTRVTLELGGKSANVVFADAD 247 Query: 266 LELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNRLGEAMQAVQFGNPAERNDIAM 325 LE A N+GQ C RV VQ+ ++D+F+ L A+ + G+P++ AM Sbjct: 248 LERAAAGAPGGAFDNAGQDCCARSRVLVQRSVFDRFLELLEPAVTGIAVGDPSD-PATAM 306 Query: 326 GPLINAAALERVEQKVARAVEEGARVAFGGKAVEGKGYYYPPTLLLDVRQEMSIMHEETF 385 GPLI+AA +R VA V E A VAF G A EG G+++PPT+L ++ EE F Sbjct: 307 GPLISAAQRDR----VASYVPEDAPVAFRGSAPEGPGFWFPPTVLTPTDPNARVLREEVF 362 Query: 386 GPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIKGLKFGETYINRENFEAM 445 GPV+ VV F+ +A+++AND++YGL S++T+++ A++ +G++ G +N + Sbjct: 363 GPVMCVVPFEDEAEAVALANDTEYGLAGSVWTRDVGRALRVARGVRAGNLSVNSHSAVRY 422 Query: 446 QGFHAGWRKSGIGGADGKHGLHEYLQTQVVYL 477 G SGIG G L + +T+ V++ Sbjct: 423 WTPFGGMGHSGIGRELGPDALEAFTETKTVFV 454 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 458 Length adjustment: 33 Effective length of query: 446 Effective length of database: 425 Effective search space: 189550 Effective search space used: 189550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory