Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_018124792.1 B149_RS0108675 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_000375485.1:WP_018124792.1 Length = 245 Score = 230 bits (586), Expect = 2e-65 Identities = 122/241 (50%), Positives = 169/241 (70%), Gaps = 7/241 (2%) Query: 3 VLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPS-----S 57 +L+++NL V YG I+A+ +SF V GE+V+LIGANGAGK+T L +++ L P S Sbjct: 5 LLEIDNLYVKYGNIEALHGISFSVQRGEIVTLIGANGAGKSTSLMSIARLPPPEAPKVIS 64 Query: 58 GKIEFLGQEIQKMPAQKIVAG-GLSQVPEGRHVFPGLTVMENLEMGAFLKKNREEN-QAN 115 G I F GQ I M K+V+ L VPEGRH+F LTV ENL++ + +K+ + + + Sbjct: 65 GDIRFEGQSILPMSPDKVVSDLHLVLVPEGRHIFGNLTVEENLKLATYARKDSHADVERD 124 Query: 116 LKKVFSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEI 175 K+V+S FPRL ER+ Q + +LSGGEQQMLA+GRALMS ++LDEPSMGLAP+ + ++ Sbjct: 125 YKRVYSLFPRLNERRRQRSESLSGGEQQMLAVGRALMSGSTTIMLDEPSMGLAPLLMYDM 184 Query: 176 FDIIQDIQKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLG 235 F ++D+ K G T+LLIEQNAN AL + RGYV++TG+IV G+ +EL EV+KAYLG Sbjct: 185 FRALKDLNKDGMTILLIEQNANLALKFAHRGYVIDTGEIVARGSSEELMEDPEVKKAYLG 244 Query: 236 G 236 G Sbjct: 245 G 245 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 245 Length adjustment: 23 Effective length of query: 213 Effective length of database: 222 Effective search space: 47286 Effective search space used: 47286 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory