Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_018124792.1 B149_RS0108675 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_000375485.1:WP_018124792.1 Length = 245 Score = 222 bits (565), Expect = 6e-63 Identities = 113/241 (46%), Positives = 163/241 (67%), Gaps = 8/241 (3%) Query: 1 MLQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCG-----SPQAHS 55 +L+ +N+ YG I+ALH ++ V++GEIVTLIGANGAGKST LM++ +P+ S Sbjct: 5 LLEIDNLYVKYGNIEALHGISFSVQRGEIVTLIGANGAGKSTSLMSIARLPPPEAPKVIS 64 Query: 56 GSIRYMGEELVGQDSSHIMRK-SIAVVPEGRRVFARLTVEENLAMGGFFT--DKGDYQEQ 112 G IR+ G+ ++ ++ + +VPEGR +F LTVEENL + + D + Sbjct: 65 GDIRFEGQSILPMSPDKVVSDLHLVLVPEGRHIFGNLTVEENLKLATYARKDSHADVERD 124 Query: 113 MDKVLHLFPRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQI 172 +V LFPRL ER QR ++SGGEQQMLA+GRALMS ++LDEPS+GLAP+++ + Sbjct: 125 YKRVYSLFPRLNERRRQRSESLSGGEQQMLAVGRALMSGSTTIMLDEPSMGLAPLLMYDM 184 Query: 173 FDIIEQLRKDGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDPKVREAYLG 232 F ++ L KDG+T+ L+EQNAN ALK A R YV++ G +V +G+ E L+ DP+V++AYLG Sbjct: 185 FRALKDLNKDGMTILLIEQNANLALKFAHRGYVIDTGEIVARGSSEELMEDPEVKKAYLG 244 Query: 233 G 233 G Sbjct: 245 G 245 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 245 Length adjustment: 23 Effective length of query: 210 Effective length of database: 222 Effective search space: 46620 Effective search space used: 46620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory