Align Diaminopimelate epimerase; DAP epimerase; EC 5.1.1.7; PLP-independent amino acid racemase (uncharacterized)
to candidate WP_018126068.1 B149_RS0115400 diaminopimelate epimerase
Query= curated2:O67693 (279 letters) >NCBI__GCF_000375485.1:WP_018126068.1 Length = 286 Score = 222 bits (566), Expect = 6e-63 Identities = 133/278 (47%), Positives = 166/278 (59%), Gaps = 14/278 (5%) Query: 3 FWKLQGSGNDFVVIDDRDEKLESFLKERGVSKEDFVRKVCAFHTGVGADGLILIKN-PDN 61 F+K+QG GNDFVVID+R+ L +D+V K+CA GV ADGL I N P Sbjct: 11 FFKMQGCGNDFVVIDNRELGLPE------AEMKDWVTKICARAFGVYADGLFFIDNAPKG 64 Query: 62 PENDFKWEFFNSDGSVAEMCGNGSRCAVRFAYERGIVGNKVRFETLAGVIKAEVYENGRK 121 D++W FFNSDGS AEMCGN SRC R AYE G + F T AG IKAEV G K Sbjct: 65 SGLDYRWHFFNSDGSRAEMCGNASRCMGRLAYELGAAPREHTFGTDAGPIKAEVILEGEK 124 Query: 122 ---VKVQLTPPSKPEEKT-LTVDGEEVIGVFINTGVPHFVVPVEDVEKVNVIKLGRAIRF 177 VK+QLTP T L VDG+ + ++TGVPH VV ++DV +++ +LG AIR+ Sbjct: 125 AGEVKIQLTPAQGMTLNTELEVDGQTLTVHHVDTGVPHAVVFLDDVNAIDIKRLGAAIRY 184 Query: 178 HEEFQPKGTNVNFVQPVSEDTIKVRTYERGVESETLACGTGATACAIVSYLKGLVKKKPV 237 H+ F P G N NF Q + +DT+ +RTYERGVE ET ACGTGA A IV++ GL + Sbjct: 185 HDHFAPAGCNANFAQVLDKDTMLLRTYERGVEDETYACGTGAAATQIVAHELGLTNAEAA 244 Query: 238 NVLTRSGEVLTIDFSEDLKEVFLTGSVYKVFEGRLSEE 275 + T GEVLTI FL G+ VF+G L E Sbjct: 245 -LTTSGGEVLTIALENG--NAFLQGAATLVFKGELYPE 279 Lambda K H 0.317 0.138 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 286 Length adjustment: 26 Effective length of query: 253 Effective length of database: 260 Effective search space: 65780 Effective search space used: 65780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate WP_018126068.1 B149_RS0115400 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
../bin/blast/fastacmd -i /tmp/list.438.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.438.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.