Align proline dehydrogenase (EC 1.5.5.2) (characterized)
to candidate WP_018233000.1 THITHI_RS0110235 FAD-dependent oxidoreductase
Query= BRENDA::Q5JFG2 (385 letters) >NCBI__GCF_000378965.1:WP_018233000.1 Length = 412 Score = 179 bits (453), Expect = 2e-49 Identities = 117/386 (30%), Positives = 195/386 (50%), Gaps = 12/386 (3%) Query: 1 MKSEAKTVIIGGGIIGLSIAYNLAK-LGESDIVVLEKGYLGNGSTFRCGTGIRQQFGDEA 59 ++ VIIGGG GL+ AY LA+ G +++ VLE+GY+G G+T R T +R + Sbjct: 25 LRDSYDVVIIGGGGHGLACAYYLARDHGITNVAVLEQGYIGGGNTGRNTTIVRSNYLTPE 84 Query: 60 NIRMMKRSVELWKGLKEELGYDVEFTQSGYLFLIYSEEELEAFNNNVRLQNRFGVPSRII 119 ++ S+ L++ L E+ ++ +++ G+ L +++ + + FG+ S ++ Sbjct: 85 GVKFYDESIRLFRDLAEDFDLNIFYSERGHFTLAHTDAAVRTMRWRAEVNKHFGIDSELV 144 Query: 120 TPEEAKEIVPPLNTD----GVIAAAWNHTDGKANPFKAV-FAYANAAKRLGVEIYEYTEA 174 E + VP L+ D + A H G AV + Y A R GVEI++ T Sbjct: 145 DREFIADAVPMLDLDCGGEHPVLGALYHVPGAVVRHDAVAWGYGRGADRRGVEIHQKTRV 204 Query: 175 KDIKVEDGKIKAVVTNRGEIRTGRVINAANAWAPLINKMAGVPIKIPIEPYKHQSVKTEP 234 I+VE G++ V T++G ++TGRVI+ P I M G+ I I P Q+ TEP Sbjct: 205 TGIRVEQGRVTGVETDKGFVKTGRVISMVAGSTPRITDMVGITTPIVIHPL--QACVTEP 262 Query: 235 IKPGQIEPMVISFKHGGVYMTQEANQGGVIGGYGLKYGPTYDITPTYDFLRGVSYRFAQI 294 +KP +V H VY++Q +++G ++ G L + T DF+ G++ + + Sbjct: 263 MKPWLDTIIVSGSLH--VYVSQ-SSRGELVMGAALDPAILHSTRSTLDFVEGLADQMLDL 319 Query: 295 IPALKYVNIIRVWGGFYAETPDHNAAIGRINEIDEFYIAAGFSGHGFMLAPVVGEALAEL 354 P L ++R W G TPD +GR ID FYI AG+ GF PV G+ +A Sbjct: 320 FPFLSRAKVMRQWAGMADMTPDFAPIMGR-TAIDGFYIDAGWGTWGFKATPVSGKTMAWT 378 Query: 355 IVDGKTDKPLDFYDPYRFERGELRGQ 380 + + + + ++ + RF+R EL G+ Sbjct: 379 VANDRDHELIEPFSLARFDRFELVGE 404 Lambda K H 0.318 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 412 Length adjustment: 31 Effective length of query: 354 Effective length of database: 381 Effective search space: 134874 Effective search space used: 134874 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory