Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate WP_019555838.1 F612_RS0100800 acetolactate synthase small subunit
Query= BRENDA::P00894 (163 letters) >NCBI__GCF_000381085.1:WP_019555838.1 Length = 163 Score = 178 bits (452), Expect = 3e-50 Identities = 90/162 (55%), Positives = 126/162 (77%), Gaps = 1/162 (0%) Query: 1 MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI 60 M+ I+S+L+ENE+GALSRV GLFS RGYNI +LTVAPT+D +LSR+T+ T G + +EQI Sbjct: 1 MKHIISMLMENEAGALSRVSGLFSARGYNIHALTVAPTEDDSLSRLTLVTSGTAQEVEQI 60 Query: 61 EKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLY 120 K L++LVDV++V +L +G+H+ERE+ML+K+ A+G R+E KR +IFRG IIDVT + Y Sbjct: 61 VKHLNRLVDVVKVLDLTEGSHIERELMLIKLSATGDLREEYKRLADIFRGDIIDVTTTTY 120 Query: 121 TVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIM 162 T+Q+ G S KLDAF+ ++ D I+E RSG VG+ RG+K + Sbjct: 121 TIQMVGQSKKLDAFIDAL-DSGLILETVRSGTVGVLRGEKCL 161 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 111 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 163 Length adjustment: 18 Effective length of query: 145 Effective length of database: 145 Effective search space: 21025 Effective search space used: 21025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate WP_019555838.1 F612_RS0100800 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.10778.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.10778.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.