Protein WP_019556547.1 in Thiomicrorhabdus arctica DSM 13458
Annotation: NCBI__GCF_000381085.1:WP_019556547.1
Length: 264 amino acids
Source: GCF_000381085.1 in NCBI
Candidate for 37 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-histidine catabolism | Ac3H11_2560 | med | ABC transporter for L-Histidine, ATPase component (characterized) | 42% | 88% | 184.9 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| sucrose catabolism | thuK | lo | ABC transporter (characterized, see rationale) | 38% | 57% | 161 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-cellobiose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 35% | 65% | 156 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-glucose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 35% | 65% | 156 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| lactose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 35% | 65% | 156 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-maltose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 35% | 65% | 156 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-maltose catabolism | thuK | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 35% | 65% | 156 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-mannose catabolism | TT_C0211 | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 35% | 65% | 156 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| sucrose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 35% | 65% | 156 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| trehalose catabolism | gtsD | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 35% | 65% | 156 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| trehalose catabolism | thuK | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 35% | 65% | 156 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| N-acetyl-D-glucosamine catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 37% | 69% | 155.6 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-glucosamine (chitosamine) catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 37% | 69% | 155.6 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Sorbitol, ATPase component (characterized) | 39% | 61% | 154.1 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| putrescine catabolism | potA | lo | Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) | 37% | 63% | 153.7 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| lactose catabolism | lacK | lo | LacK, component of Lactose porter (characterized) | 35% | 62% | 151 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| L-proline catabolism | proV | lo | glycine betaine/l-proline transport atp-binding protein prov (characterized) | 39% | 53% | 150.6 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-mannitol catabolism | mtlK | lo | ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) | 33% | 68% | 149.8 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-maltose catabolism | malK | lo | ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) | 38% | 57% | 149.4 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-maltose catabolism | malK_Aa | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 33% | 65% | 147.9 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-galactose catabolism | PfGW456L13_1897 | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 37% | 54% | 146.7 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| trehalose catabolism | malK | lo | MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) | 35% | 61% | 146.7 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| xylitol catabolism | Dshi_0546 | lo | ABC transporter for Xylitol, ATPase component (characterized) | 36% | 69% | 144.8 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-cellobiose catabolism | SMc04256 | lo | ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) | 34% | 68% | 143.3 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| xylitol catabolism | HSERO_RS17020 | lo | ABC-type sugar transport system, ATPase component protein (characterized, see rationale) | 36% | 58% | 143.3 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-glucosamine (chitosamine) catabolism | SM_b21216 | lo | ABC transporter for D-Glucosamine, ATPase component (characterized) | 36% | 57% | 142.9 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| L-proline catabolism | opuBA | lo | BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) | 40% | 51% | 139.8 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-cellobiose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 59% | 138.3 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-glucose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 59% | 138.3 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| lactose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 59% | 138.3 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-maltose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 59% | 138.3 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-maltose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 59% | 138.3 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| sucrose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 59% | 138.3 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| sucrose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 59% | 138.3 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| trehalose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 59% | 138.3 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| trehalose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 36% | 59% | 138.3 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
| D-cellobiose catabolism | msiK | lo | MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) | 35% | 51% | 130.2 | Nitrate import ATP-binding protein NrtD; EC 7.3.2.4 | 55% | 297.0 |
Sequence Analysis Tools
View WP_019556547.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MSEVHLELTNVGIEFPTPRGPFRALRDINLKIDQGEFVSLIGHSGCGKSTVLNIVAGLYE
ATEGGVLLDGREVNSPGPERAVVFQNHSLLPWLSAYENVELAVDQVFKKSKTAAEKKEWI
EYNLKLVHMDHAMHKRPDEISGGMKQRVGIARALAMQPEVMLMDEPFGALDALTRAHLQD
SLMEIQKALNNTVIMITHDVDEAVLLSDRIVMMTNGPNATIGEILKIDLPHPRDRLALAD
DPTYNHYRSEVMRFLYEKQRKVEH
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory