Align High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale)
to candidate WP_019556899.1 F612_RS0106230 LPS export ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWS6 (255 letters) >NCBI__GCF_000381085.1:WP_019556899.1 Length = 240 Score = 141 bits (356), Expect = 1e-38 Identities = 80/233 (34%), Positives = 130/233 (55%), Gaps = 15/233 (6%) Query: 21 VNGVALTVKEKQVVALIGPNGAGKTTVFNCLTGFYQPTGGTILLDGEPIQGLPGHHIARK 80 V V + V QVV L+GPNGAGKTT F +TG G + LD + I LP H A+ Sbjct: 19 VASVDIDVYSGQVVGLLGPNGAGKTTTFYMMTGLVDNDKGLLFLDDQEISRLPIHKRAKL 78 Query: 81 GVVRTFQNVRLFKDMTAVENLLIAQHRHLNTNFFAGLFKTPAFRKSEREAMEYAEYWLDK 140 G+ Q +F+ + EN++ A L P K +R + E +D Sbjct: 79 GIGYLPQEASVFRKLNVTENIM------------AILEMRPELSKDQRNII--FENLIDD 124 Query: 141 VNLTEFANRPAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAGLNPKETEDLKALIGVLR 200 + + +P L+ G++RR+EIAR + PR ++LDEP AG++P +D++++I L+ Sbjct: 125 LQIGHILEQPGQALSGGERRRVEIARALAMEPRFILLDEPFAGVDPISVKDIQSIILHLK 184 Query: 201 EEHNVTVLLIEHDMKLVMSISDHIVVINQGTPLADGTPEQIRDNPEVIKAYLG 253 ++ + VL+ +H+++ ++ + DH +++ GT LA GTP++I NPEV + YLG Sbjct: 185 DK-GIGVLITDHNVREILGVCDHAYILHAGTILAAGTPDEILANPEVKRVYLG 236 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 240 Length adjustment: 24 Effective length of query: 231 Effective length of database: 216 Effective search space: 49896 Effective search space used: 49896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory