Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate WP_019557546.1 F612_RS0109560 proline/glycine betaine ABC transporter permease ProW
Query= SwissProt::P14176 (354 letters) >NCBI__GCF_000381085.1:WP_019557546.1 Length = 359 Score = 401 bits (1031), Expect = e-116 Identities = 202/350 (57%), Positives = 256/350 (73%), Gaps = 7/350 (2%) Query: 5 NNPWDTTPAADSAAQSADAWGTPTTAPTDGGG--ADWLTSTPAPNVEH--FNILDPFHKT 60 NNPW+T + +++ WG+ T PT+ ADWLT A + F+ DPF + Sbjct: 4 NNPWETPSQPEP---TSNPWGSAETIPTESISPQADWLTQAGAVDNTQTAFSWTDPFAQK 60 Query: 61 LIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGFQQLLLGMPAPVAIIVFALIAWQI 120 LIPLD WV G+DW+V +FR VFQ +R+PVD IL Q LL + ++ F L AWQI Sbjct: 61 LIPLDHWVENGLDWLVDNFRDVFQAIRIPVDVILTALQTFLLSLNPWFVLVFFTLFAWQI 120 Query: 121 SGVGMGVATLVSLIAIGAIGAWSQAMVTLALVLTALLFCIVIGLPLGIWLARSPRAAKII 180 G +G+ + SL+ IG +GAW + MVTLALV TA+LF +++G+PLGIW+ +S R I Sbjct: 121 GGRKLGILSAASLLIIGFLGAWPETMVTLALVFTAVLFSMLVGIPLGIWMGKSNRMQSIF 180 Query: 181 RPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEA 240 P+LDAMQTTPAFVYL+PIVMLFGIGNVPGVVVTIIF+LPP++RLT LGI QVPADLIEA Sbjct: 181 MPILDAMQTTPAFVYLIPIVMLFGIGNVPGVVVTIIFSLPPLVRLTSLGIRQVPADLIEA 240 Query: 241 SRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGR 300 ++GA P QMLFK++LP+A TIMAG+NQ LML+LSMVVIASMIAVGGLGQMVLRGIGR Sbjct: 241 GHAYGAHPLQMLFKIELPVAKATIMAGINQNLMLSLSMVVIASMIAVGGLGQMVLRGIGR 300 Query: 301 LDMGLATVGGVGIVILAIILDRLTQAVGRDSRSRGNRRWYTTGPVGLLTR 350 LDMGLA +GG+ IV+LAI+LDR+TQ++G+ +S WY P+ L + Sbjct: 301 LDMGLAAIGGLSIVLLAIMLDRITQSMGQQPKSNTRIHWYQREPLWWLLK 350 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 359 Length adjustment: 29 Effective length of query: 325 Effective length of database: 330 Effective search space: 107250 Effective search space used: 107250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory