Align Putative succinate-semialdehyde dehydrogenase [NADP(+)]; SSADH; SSDH; EC 1.2.1.79 (uncharacterized)
to candidate WP_019866847.1 METMI_RS0113630 hypothetical protein
Query= curated2:A0R4Q0 (517 letters) >NCBI__GCF_000384075.1:WP_019866847.1 Length = 530 Score = 244 bits (622), Expect = 7e-69 Identities = 162/462 (35%), Positives = 231/462 (50%), Gaps = 10/462 (2%) Query: 34 TGRELTTIPVGTAEDVAAAFAKARAAQRGWAHRPVAERAAIMERFRDLVAKNRDFLMDVA 93 T + L + P+ A ++ A A+ A WA + +R I+ + ++ + D + +V Sbjct: 12 TEQALNSYPITQANEITGIMASAQQAATIWAQTGIKQRVNILSHLQAIILADFDPITEVI 71 Query: 94 QAETGKARSAAQ-EEIVDMMLNARYYARQAVKLLAPKRVQG--LLPGVVKTVVNHHPKGV 150 + TGK ++ EI ++ RYY + A +LAP+ + L P GV Sbjct: 72 MSATGKVKTEVLLGEIYFVLELLRYYQQHAASILAPRPIHTAPLAFPQASAAYERKPYGV 131 Query: 151 VGVISPWNYPMALSISDSIPALLAGNAVVVKPDSQTPYCTLANAELLYEAGLPRDLFAVV 210 V +ISPWN+P L++S + AL +GNAVV K + ELL + LP L V Sbjct: 132 VAIISPWNFPFQLTLSPLLTALFSGNAVVFKMSELSLPVGELIEELLAKLDLPEGLVQQV 191 Query: 211 PGPGSVVGTAIVENCDYLMFTGSTATGRTLAEQCGRRLIGFSAELGGKNPMIVTRGAKLD 270 G I D + FTGS A GR + + + I ELGGK+ MIV A L Sbjct: 192 IGEADTGTKLINARPDLVFFTGSVAAGRAVMTRAAQHPIPVVLELGGKDAMIVFADAHLQ 251 Query: 271 VAAKAATRACFSNAGQLCISIERIYVERAVADEFTAKFGEQVRSMRLAATYDFTADMGSL 330 A KAA FSN+GQ+C+SIER YVE EF + E V + + + D+G L Sbjct: 252 RAVKAAMYGAFSNSGQVCVSIERCYVEALCYAEFVGQLVEAVAEITVG--HGAVGDLGGL 309 Query: 331 ISEDQIKTVSGHVDDAKAKGATVIAGGNIRPDIGPRFYEPTVLTGVTDEMECARNETFGP 390 S Q + +DA AKGA A +R + R+ P VL VT +M R ETFG Sbjct: 310 TSLKQFAVIEAQYNDALAKGAK--ASSPLR--LEGRYLRPVVLWDVTHDMLIMREETFGL 365 Query: 391 VVSIYPVESVAEAIEKANDTEYGLNASVWAGSKTEGEAIAAQLQAGTVNVDEGYALAFGS 450 ++ + ES A+AIE AND+E+GLNASVW+ + E +A QL+ G V++ G Sbjct: 366 LLPVMAFESEAQAIELANDSEFGLNASVWSRDIAKAELVAKQLKVGNWAVND-VIKNIGH 424 Query: 451 TAAPMGGMKASGVGRRHGADGILKYTESQTVATSRVLNLDPP 492 P GG+K SG GR HGA+G+ ++T + TSR D P Sbjct: 425 VGLPFGGVKNSGFGRYHGAEGLRQFTYTVAGLTSRTTLDDEP 466 Lambda K H 0.317 0.132 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 552 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 517 Length of database: 530 Length adjustment: 35 Effective length of query: 482 Effective length of database: 495 Effective search space: 238590 Effective search space used: 238590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory