Align UDP-glucose 4-epimerase (EC 5.1.3.7; EC 5.1.3.2) (characterized)
to candidate WP_019867605.1 METMI_RS0117540 UDP-glucose 4-epimerase GalE
Query= metacyc::BSU38860-MONOMER (339 letters) >NCBI__GCF_000384075.1:WP_019867605.1 Length = 353 Score = 461 bits (1186), Expect = e-134 Identities = 222/345 (64%), Positives = 270/345 (78%), Gaps = 10/345 (2%) Query: 3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLLDR 62 ILVTGGAGYIGSH CVELL +GY+IVV DNLSNS E+L RV++ITGK+L FY+AD+ D+ Sbjct: 7 ILVTGGAGYIGSHACVELLQAGYDIVVADNLSNSKTESLARVQQITGKNLKFYQADIRDK 66 Query: 63 EAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFS 122 A+D +F +N I+ VIHFAGLKAVGES + P YYHNN+ GT +L EAM+ GVK++VFS Sbjct: 67 AALDEIFDQNPIDTVIHFAGLKAVGESCSKPHLYYHNNVYGTLVLTEAMQAAGVKRLVFS 126 Query: 123 SSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTAD------NEWSVALLRY 176 SSATVYG +T EDFPLGA NPYG++K M+E ILRDL AD + W +ALLRY Sbjct: 127 SSATVYGESDTPQYAEDFPLGAINPYGRSKAMIEDILRDLSAADHINQDPSPWKIALLRY 186 Query: 177 FNPFGAHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVV 236 FNP GAH SG IGEDPNGIPNNLMPY++QVAVGKL QLSVFGNDYPT DGTG+RDYIHVV Sbjct: 187 FNPIGAHASGLIGEDPNGIPNNLMPYISQVAVGKLAQLSVFGNDYPTPDGTGIRDYIHVV 246 Query: 237 DLAEGHVKALEKV----LNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRP 292 DL +GH+KA+E + G AYNLGTG GYSVLEM++AFE+V+GK + Y+ RR Sbjct: 247 DLVKGHIKAIETLDSDAFGPGGCKAYNLGTGRGYSVLEMIQAFERVTGKAINYQIVGRRA 306 Query: 293 GDIATCFADPAKAKRELGWEAKRGLEEMCADSWRWQSSNVNGYKS 337 GD+A CFA+P +A +ELGW+A++ L++M AD+W WQS N GY S Sbjct: 307 GDLAECFANPKRALQELGWQAEKNLDDMVADTWNWQSKNPQGYGS 351 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 353 Length adjustment: 29 Effective length of query: 310 Effective length of database: 324 Effective search space: 100440 Effective search space used: 100440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_019867605.1 METMI_RS0117540 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.20086.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-140 454.2 0.0 1.2e-140 454.0 0.0 1.0 1 lcl|NCBI__GCF_000384075.1:WP_019867605.1 METMI_RS0117540 UDP-glucose 4-ep Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000384075.1:WP_019867605.1 METMI_RS0117540 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 454.0 0.0 1.2e-140 1.2e-140 1 331 [. 6 348 .. 6 349 .. 0.97 Alignments for each domain: == domain 1 score: 454.0 bits; conditional E-value: 1.2e-140 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavle 67 kiLvtGgaGyiGsh +++ll++g+++vv Dnls++++e+l ++++it ++k++++d++dk++l+++++ lcl|NCBI__GCF_000384075.1:WP_019867605.1 6 KILVTGGAGYIGSHACVELLQAGYDIVVADNLSNSKTESLARVQQITgkNLKFYQADIRDKAALDEIFD 74 79********************************************9999******************* PP TIGR01179 68 eekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEe 136 ++ id+viHfa+l+avgEs ++P YY+nnv +tl+L eamq+agvk+l+Fsssa+vYges++ + E+ lcl|NCBI__GCF_000384075.1:WP_019867605.1 75 QNPIDTVIHFAGLKAVGESCSKPHLYYHNNVYGTLVLTEAMQAAGVKRLVFSSSATVYGESDTPQYAED 143 ********************************************************************* PP TIGR01179 137 splnpinpYGrsklmvErilkdlkkadk......elkvviLRYFnvaGAdeegeiGeasknat.hlikl 198 +pl++inpYGrsk+m+E il+dl+ ad+ +k+++LRYFn++GA+ +g iGe++++++ +l+++ lcl|NCBI__GCF_000384075.1:WP_019867605.1 144 FPLGAINPYGRSKAMIEDILRDLSAADHinqdpsPWKIALLRYFNPIGAHASGLIGEDPNGIPnNLMPY 212 ***********************999743333336****************************9***** PP TIGR01179 199 vaevavgkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeg....gesevynlGagqgfs 263 + +vavgk+ +l++fG+dypt+DGt++RDyiHv Dl ++H++a+e+l + g+ ++ynlG+g+g+s lcl|NCBI__GCF_000384075.1:WP_019867605.1 213 ISQVAVGKLAQLSVFGNDYPTPDGTGIRDYIHVVDLVKGHIKAIETLDSDafgpGGCKAYNLGTGRGYS 281 ***********************************************9864555799************ PP TIGR01179 264 vkevieavkkvsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklkeg 331 v+e+i+a+++v+gk i++++ rRaGD+a+++a+++++ +elgw+++ + L+++++++w+W++k+++g lcl|NCBI__GCF_000384075.1:WP_019867605.1 282 VLEMIQAFERVTGKAINYQIVGRRAGDLAECFANPKRALQELGWQAEKN-LDDMVADTWNWQSKNPQG 348 ***********************************************99.***************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.78 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory