Align 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) (characterized)
to candidate WP_019867955.1 METMI_RS0119340 NAD(P)-dependent oxidoreductase
Query= BRENDA::Q8ZLV8 (296 letters) >NCBI__GCF_000384075.1:WP_019867955.1 Length = 286 Score = 173 bits (438), Expect = 5e-48 Identities = 106/283 (37%), Positives = 156/283 (55%), Gaps = 7/283 (2%) Query: 3 MKVGFIGLGIMGKPMSKNLLKAGYSLVVSDRNP---EAIADVIAAGAETASTAKAIAEQC 59 M+VGFIGLG MG M++NL KAG V +R +A+A +A A K A+ Sbjct: 1 MQVGFIGLGAMGLGMARNLAKAGLLAGVYNRTAAKAQALAAELAVVTAYADITKLAADM- 59 Query: 60 DVIITMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLD 119 DV++T + V V G AK GTV++DMS+++ +++ + L+AKGV +D Sbjct: 60 DVVLTCVSADSDVLAVVAAIAGT---AKAGTVVVDMSTVSSGTAQQAAVLLRAKGVAFVD 116 Query: 120 APVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGDIGAGNVTKLANQVIV 179 APVSGG A +GTLS+M+GGD DK +++AM+ ++H G G+G TK NQV+ Sbjct: 117 APVSGGVEGANNGTLSIMIGGDADTLDKVRPVLEAMSSRIIHVGPTGSGQATKAVNQVMC 176 Query: 180 ALNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHI 239 A A++EAL A + + V A+ GG AG+ LD + + F PGF++ LH Sbjct: 177 AGINQAVTEALAFAAAQNLPMEKVIDAVAGGAAGNWFLDKRGKTMTSGTFAPGFKLALHH 236 Query: 240 KDLANALDTSHGVGAQLPLTAAVMEMMQALRADGHGNDDHSAL 282 KDL + +PL+ + + L A GHG++D SAL Sbjct: 237 KDLKICQRMAENAQVAIPLSVMTITEYEQLMAAGHGDEDISAL 279 Lambda K H 0.316 0.132 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 286 Length adjustment: 26 Effective length of query: 270 Effective length of database: 260 Effective search space: 70200 Effective search space used: 70200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory