GapMind for catabolism of small carbon sources

 

Alignments for a candidate for maiA in Hydrogenovibrio halophilus DSM 15072

Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate WP_019894155.1 A377_RS0100760 stringent starvation protein A

Query= reanno::psRCH2:GFF3446
         (219 letters)



>NCBI__GCF_000384235.1:WP_019894155.1
          Length = 213

 Score = 52.8 bits (125), Expect = 5e-12
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 9/112 (8%)

Query: 5   LTLYGYWRSSAAYRVRIALNLKGLAYRQVPVHLVK-DGGQQRAADYRALNPQQLVPLLVD 63
           +TL+   +S +++RVR+    K      +P+ +V+ D  +    D   LNP   +P LVD
Sbjct: 12  MTLFSDSKSPSSHRVRLMAKEK-----DIPMEIVEVDTSEGMPEDLVELNPYGTLPTLVD 66

Query: 64  EGNGGARISQSLAILEYLDEVFPVPALLPADPVERAQVRSLAMHIACEIHPL 115
                  +     I+EYLDE FP P LL  DP+ +A+ R +   I  E + L
Sbjct: 67  RD---LVLYDPQVIIEYLDERFPHPPLLSVDPISKARSRQMLRQIELEWYSL 115


Lambda     K      H
   0.321    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 107
Number of extensions: 8
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 219
Length of database: 213
Length adjustment: 22
Effective length of query: 197
Effective length of database: 191
Effective search space:    37627
Effective search space used:    37627
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory