Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate WP_019894155.1 A377_RS0100760 stringent starvation protein A
Query= reanno::psRCH2:GFF3446 (219 letters) >NCBI__GCF_000384235.1:WP_019894155.1 Length = 213 Score = 52.8 bits (125), Expect = 5e-12 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 9/112 (8%) Query: 5 LTLYGYWRSSAAYRVRIALNLKGLAYRQVPVHLVK-DGGQQRAADYRALNPQQLVPLLVD 63 +TL+ +S +++RVR+ K +P+ +V+ D + D LNP +P LVD Sbjct: 12 MTLFSDSKSPSSHRVRLMAKEK-----DIPMEIVEVDTSEGMPEDLVELNPYGTLPTLVD 66 Query: 64 EGNGGARISQSLAILEYLDEVFPVPALLPADPVERAQVRSLAMHIACEIHPL 115 + I+EYLDE FP P LL DP+ +A+ R + I E + L Sbjct: 67 RD---LVLYDPQVIIEYLDERFPHPPLLSVDPISKARSRQMLRQIELEWYSL 115 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 107 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 213 Length adjustment: 22 Effective length of query: 197 Effective length of database: 191 Effective search space: 37627 Effective search space used: 37627 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory