Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_020177275.1 A3OQ_RS0120260 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_000385335.1:WP_020177275.1 Length = 298 Score = 343 bits (879), Expect = 4e-99 Identities = 178/285 (62%), Positives = 214/285 (75%), Gaps = 21/285 (7%) Query: 14 LLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITF 73 LL+VEHL+M+FGGL A++D SFEA+ G+ITALIGPNGAGKTT+FNCITGFYKP G I Sbjct: 5 LLRVEHLTMRFGGLTAVDDVSFEARGGEITALIGPNGAGKTTLFNCITGFYKPDAGRIVL 64 Query: 74 NQ------------KSGKQY---------LLERLPDFRITKEARVARTFQNIRLFSGLTV 112 Q +SG+++ LLER+ D I + VARTFQNIRLFSG+T Sbjct: 65 MQGEPKAADIDRLTRSGRRHGVFASGDICLLERMSDAEIARRGHVARTFQNIRLFSGMTA 124 Query: 113 LENLLVAQHNKLMKASGYTILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDL 172 LENL+VA+HN+LM ASGYTILGL+G+G Y EA+E A++WL K L + ADD AG+L Sbjct: 125 LENLIVARHNQLMAASGYTILGLLGIGAYHTTEKEAVEAAKYWLAKIGLAEHADDAAGNL 184 Query: 173 PYGAQRRLEIARAMCTGPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDM 232 YGAQR+LEIARAM T P LLCLDEPAAGLN ES+ LN LL+ IR GTSILLIEHDM Sbjct: 185 SYGAQRQLEIARAMMTEPLLLCLDEPAAGLNAAESSKLNELLRDIRQTHGTSILLIEHDM 244 Query: 233 SVVMEISDHVVVLEYGQKISDGTPDHVKNDPRVIAAYLGVEDEEV 277 SVVM ISDHVVVL+YG+KI++GT V+ D V+AAYLGVED+E+ Sbjct: 245 SVVMSISDHVVVLDYGRKIAEGTASAVRRDENVVAAYLGVEDDEL 289 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 298 Length adjustment: 26 Effective length of query: 266 Effective length of database: 272 Effective search space: 72352 Effective search space used: 72352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory