Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_020177276.1 A3OQ_RS0120265 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000385335.1:WP_020177276.1 Length = 243 Score = 302 bits (774), Expect = 4e-87 Identities = 154/234 (65%), Positives = 189/234 (80%), Gaps = 1/234 (0%) Query: 11 LLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVF 70 LL + GV+ +YG + AL GV +H+++GEIV+LIGANGAGKSTLMMTI G PQAR G ++F Sbjct: 10 LLSIEGVKAFYGPVAALKGVALHIDEGEIVTLIGANGAGKSTLMMTIFGKPQAREGHILF 69 Query: 71 EGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVEKIFTLF 130 +G DIT THEIAR +AQ PEGRR+FPRMTV ENLQMGA L+ FA D+E++ F Sbjct: 70 DGEDITHRKTHEIARAGLAQVPEGRRVFPRMTVFENLQMGA-LNGNGSFARDLERVVDHF 128 Query: 131 PRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRKLN 190 P L R QR GTLSGGEQQML+IGRALM+RP+LLLLDEPSLGLAPLIVK IF+ +++LN Sbjct: 129 PWLGTRATQRAGTLSGGEQQMLAIGRALMSRPRLLLLDEPSLGLAPLIVKQIFDVLKRLN 188 Query: 191 EAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYLEG 244 EGLTVFLVEQNA+ AL+L+ RAYVMVNG+++ +G+G ELLA ++RAAYL G Sbjct: 189 RDEGLTVFLVEQNAYHALKLADRAYVMVNGEISHAGAGAELLARDDIRAAYLGG 242 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 243 Length adjustment: 24 Effective length of query: 223 Effective length of database: 219 Effective search space: 48837 Effective search space used: 48837 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory