Align 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (characterized)
to candidate WP_020564183.1 A3OW_RS0114560 4-hydroxyphenylpyruvate dioxygenase
Query= reanno::psRCH2:GFF3449 (361 letters) >NCBI__GCF_000372865.1:WP_020564183.1 Length = 354 Score = 422 bits (1085), Expect = e-123 Identities = 221/360 (61%), Positives = 257/360 (71%), Gaps = 9/360 (2%) Query: 1 MNAVNKIEQHNPIGTDGFEFVEFTAPNAEGIEQLRTLFTQMGFTETAKHRSKEVWLFQQH 60 MNA+ I NP+GTDGFEFVE+TAP+ +E+L F MGF A+HRSK+V L++Q Sbjct: 1 MNAM--INASNPVGTDGFEFVEYTAPDTRELEKL---FVSMGFAAVARHRSKDVVLYRQG 55 Query: 61 DINIVLNGSPTGHVHAFAEKHGPSACAMAFRVKNAAQAAAYVESQGAKLVGSHANFGELN 120 IN ++N P AFA HGPS CA A RVKNAA+ GA+ + ELN Sbjct: 56 RINFIINHEPASFAQAFARVHGPSICAFAIRVKNAAECFKRALELGAEPHRGNVGPMELN 115 Query: 121 IPCVEGIGGSLLYLVDRYGDK-SIYDVDFEYIEGRTPNDNAVGLMCIDHLTHNVMRGQMD 179 IP + GIG SL+YLVDRYG++ SIYDVDF + G GL IDHLTHNV G MD Sbjct: 116 IPAIRGIGRSLIYLVDRYGEEHSIYDVDFVPLPGADLKPEGAGLTEIDHLTHNVYHGDMD 175 Query: 180 VWSGFYERIANFREIRYFDIEGKLTGLFSRAMTAPCGKIRIPINESADDKSQIEEFIREY 239 W+ FY R+ NF EIRYFDI GK+TGL SRAMT+PCGKIRIPINE D KSQI+E++ Y Sbjct: 176 RWAEFYRRLFNFHEIRYFDIHGKMTGLKSRAMTSPCGKIRIPINEPTDAKSQIQEYLAAY 235 Query: 240 HGEGIQHIALSTDDIYATVRQLRANGVDFMTTPDTYYEKVDTRVAGHGEPTDVLRELNIL 299 HGEGIQHIAL+TDDIY V QLRANGV FM PD YYE +D R+ H EP LR+ IL Sbjct: 236 HGEGIQHIALATDDIYGAVEQLRANGVRFMDVPDAYYETIDVRLPRHREPVARLRQDGIL 295 Query: 300 IDGA--PGDDGILLQIFTNTVIGPIFFEIIQRKGNQGFGEGNFKALFESIEEDQLRRGVI 357 IDG PG G+LLQIFTNTVIGPIFFEIIQRKGN+GFGEGNF+ALFE+IE DQ+RRGVI Sbjct: 296 IDGTHEPG-GGLLLQIFTNTVIGPIFFEIIQRKGNEGFGEGNFQALFEAIERDQIRRGVI 354 Lambda K H 0.320 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 501 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 354 Length adjustment: 29 Effective length of query: 332 Effective length of database: 325 Effective search space: 107900 Effective search space used: 107900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_020564183.1 A3OW_RS0114560 (4-hydroxyphenylpyruvate dioxygenase)
to HMM TIGR01263 (hppD: 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01263.hmm # target sequence database: /tmp/gapView.3793343.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01263 [M=353] Accession: TIGR01263 Description: 4HPPD: 4-hydroxyphenylpyruvate dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-130 420.3 0.0 4.6e-130 420.2 0.0 1.0 1 NCBI__GCF_000372865.1:WP_020564183.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000372865.1:WP_020564183.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 420.2 0.0 4.6e-130 4.6e-130 2 352 .. 15 353 .. 14 354 .] 0.96 Alignments for each domain: == domain 1 score: 420.2 bits; conditional E-value: 4.6e-130 TIGR01263 2 gfdfvefavgdakqaakalveklGfeavaketgsrekastvlrqgeitlvltaelsssseaaaflakHGdgvk 74 gf+fve++++d++ +++l+ ++Gf+ava+ +r+k+++++rqg+i++++++e++s a+af++ HG++++ NCBI__GCF_000372865.1:WP_020564183.1 15 GFEFVEYTAPDTR-ELEKLFVSMGFAAVAR---HRSKDVVLYRQGRINFIINHEPASF--AQAFARVHGPSIC 81 8***********9.8999999********8...**********************999..************* PP TIGR01263 75 dvafevedveaafeaavergaeavsapeeedekevklaaikgiGdvvltlveregekgsilpgfeevsekaal 147 + a++v++++++f++a+e gae+ + ++ +e++++ai+giG ++++lv+r+ge++si+++++ a NCBI__GCF_000372865.1:WP_020564183.1 82 AFAIRVKNAAECFKRALELGAEPHRGNVG--PMELNIPAIRGIGRSLIYLVDRYGEEHSIYDVDFVPLPGA-- 150 ***********************999996..99******************************99777765.. PP TIGR01263 148 kekledvgleaiDHvvgnvergelekvaefyekilgfkeiksfdikteasaLkSkvlasaegkvklplnepas 220 + k+e++gl++iDH+++nv++g+++++aefy+++++f+ei++fdi++++++LkS++++s++gk+++p+nep NCBI__GCF_000372865.1:WP_020564183.1 151 DLKPEGAGLTEIDHLTHNVYHGDMDRWAEFYRRLFNFHEIRYFDIHGKMTGLKSRAMTSPCGKIRIPINEP-- 221 45559*****************************************************************8.. PP TIGR01263 221 kkkksQIeeyleeyeGaGvQHlAlntedivktveelrargveflkipetYYdnlkervkklvkedleelkelk 293 ++ ksQI+eyl++y+G+G+QH+Al t+di+ +ve+lra+gv+f+++p++YY++++ r+++ ++e++ +l++ + NCBI__GCF_000372865.1:WP_020564183.1 222 TDAKSQIQEYLAAYHGEGIQHIALATDDIYGAVEQLRANGVRFMDVPDAYYETIDVRLPR-HREPVARLRQDG 293 899********************************************************7.************ PP TIGR01263 294 iLvDrd...eeGlLLQiFtkpvvdrgtlFfEiIqRkgakGFGegNfkaLfeaiEreqekrgv 352 iL+D+ GlLLQiFt++v+ g++FfEiIqRkg++GFGegNf+aLfeaiEr+q++rgv NCBI__GCF_000372865.1:WP_020564183.1 294 ILIDGThepGGGLLLQIFTNTVI--GPIFFEIIQRKGNEGFGEGNFQALFEAIERDQIRRGV 353 *****9744456***********..***********************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (353 nodes) Target sequences: 1 (354 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 27.15 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory